IGF1 (NM_000618) Human Recombinant Protein
CAT#: TP723176
Purified recombinant protein of Human insulin-like growth factor 1 (somatomedin C) (IGF1), transcript variant 4.
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
|
| Tag | Tag Free |
| Predicted MW | 7.6 kDa |
| Concentration | Resuspend the protein in the desired concentration in proper buffer |
| Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
| Bioactivity | ED50 was determined by a cell proliferation assay using FDC-P1 cells is less than or equal to 2.0 ng/ml, corresponding to a specific activity of > 5 x 10^5 units/mg. |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
| Storage | Store at -80°C. |
| Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_000609 |
| Locus ID | 3479 |
| UniProt ID | P05019, Q5U743, Q59GC5 |
| Cytogenetics | 12q23.2 |
| Refseq Size | 7260 |
| Refseq ORF | 459 |
| Synonyms | IGF; IGF-I; IGFI; MGF |
| Summary | 'The protein encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development. The encoded protein is processed from a precursor, bound by a specific receptor, and secreted. Defects in this gene are a cause of insulin-like growth factor I deficiency. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein. [provided by RefSeq, Sep 2015]' |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein |
| Protein Pathways | Dilated cardiomyopathy, Focal adhesion, Glioma, Hypertrophic cardiomyopathy (HCM), Long-term depression, Melanoma, mTOR signaling pathway, Oocyte meiosis, p53 signaling pathway, Pathways in cancer, Progesterone-mediated oocyte maturation, Prostate cancer |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400206 | IGF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC426358 | IGF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC426359 | IGF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400206 | Transient overexpression lysate of insulin-like growth factor 1 (somatomedin C) (IGF1), transcript variant 4 |
USD 436.00 |
|
| LY426358 | Transient overexpression lysate of insulin-like growth factor 1 (somatomedin C) (IGF1), transcript variant 1 |
USD 436.00 |
|
| LY426359 | Transient overexpression lysate of insulin-like growth factor 1 (somatomedin C) (IGF1), transcript variant 2 |
USD 436.00 |
|
| PH312527 | IGF1 MS Standard C13 and N15-labeled recombinant protein (NP_000609) |
USD 2,055.00 |
|
| TP312527 | Recombinant protein of human insulin-like growth factor 1 (somatomedin C) (IGF1), transcript variant 4 |
USD 748.00 |
|
| TP720018 | Recombinant protein of human insulin-like growth factor 1 (somatomedin C) (IGF1), transcript variant 4 |
USD 330.00 |
|
| TP720023 | Recombinant protein of human insulin-like growth factor 1 (somatomedin C) (IGF1), transcript variant 4 |
USD 330.00 |
|
| TP721030 | Purified recombinant protein of Human insulin-like growth factor 1 (somatomedin C) (IGF1), transcript variant 4 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China