PIM3 (NM_001001852) Human Mass Spec Standard

CAT#: PH312690

PIM3 MS Standard C13 and N15-labeled recombinant protein (NP_001001852)

Product Images

Coomassie blue staining of purified PIM3 protein (Cat# TP312690). The protein was produced from HEK293T cells transfected with PIM3 cDNA clone (Cat# RC212690) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212690
• Predicted MW: 35.7 kDa
• Protein Sequence:
  Sequence Link

  >RC212690 representing NM_001001852
  Red=Cloning site Green=Tags(s)
  
  MLLSKFGSLAHLCGPGGVDHLPVKILQPAKADKESFEKAYQVGAVLGSGGFGTVYAGSRIADGLPVAVKH
  VVKERVTEWGSLGGATVPLEVVLLRKVGAAGGARGVIRLLDWFERPDGFLLVLERPEPAQDLFDFITERG
  ALDEPLARRFFAQVLAAVRHCHSCGVVHRDIKDENLLVDLRSGELKLIDFGSGALLKDTVYTDFDGTRVY
  SPPEWIRYHRYHGRSATVWSLGVLLYDMVCGDIPFEQDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSE
  RPSLDQIAAHPWMLGADGGAPESCDLRLCTLDPDDVASTTSSSESL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001001852
• RefSeq Size: 2392
• RefSeq ORF: 978
• Synonyms: pim-3
• Locus ID: 415116
• UniProt ID: Q86V86
• Cytogenetics: 22q13.33
• Summary: The protein encoded by this gene belongs to the Ser/Thr protein kinase family, and PIM subfamily. This gene is overexpressed in hematological and epithelial tumors and is associated with MYC coexpression. It plays a role in the regulation of signal transduction cascades, contributing to both cell proliferation and survival, and provides a selective advantage in tumorigenesis. [provided by RefSeq, Jun 2012]
• Protein Families: Druggable Genome, Protein Kinase