Parathyroid hormone related protein (PTHLH) (NM_198966) Human Mass Spec Standard

CAT#: PH312744

PTHLH MS Standard C13 and N15-labeled recombinant protein (NP_945317)

Product Images

Coomassie blue staining of purified PTHLH protein (Cat# TP312744). The protein was produced from HEK293T cells transfected with PTHLH cDNA clone (Cat# RC212744) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212744
• Predicted MW: 16 kDa
• Protein Sequence:
  Sequence Link

  >RC212744 representing NM_198966
  Red=Cloning site Green=Tags(s)
  
  MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA
  EIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKK
  RRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRRH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_945317
• RefSeq Size: 1312
• RefSeq ORF: 531
• Synonyms: BDE2; HHM; PLP; PTHR; PTHRP
• Locus ID: 5744
• UniProt ID: P12272, A0A024RB29
• Cytogenetics: 12p11.22
• Summary: 'The protein encoded by this gene is a member of the parathyroid hormone family. This hormone, via its receptor, PTHR1, regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. It is responsible for most cases of humoral hypercalcemia of malignancy, and mutations in this gene are associated with brachydactyly type E2 (BDE2). Alternatively spliced transcript variants have been found for this gene. There is also evidence for alternative translation initiation from non-AUG (CUG and GUG) start sites, downstream of the initiator AUG codon, resulting in nuclear forms of this hormone. [provided by RefSeq, Nov 2013]'
• Protein Families: Druggable Genome, Secreted Protein