Parathyroid hormone related protein (PTHLH) (NM_002820) Human Recombinant Protein

CAT#: TP723372

Purified recombinant protein of Human parathyroid hormone-like hormone (PTHLH), transcript variant 2.

Product Images

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTP
• Tag: Tag Free
• Predicted MW: 9.8 kDa
• Concentration: Reconstitute with water to a concentration of 0.1-1 mg/ml.
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002811
• Locus ID: 5744
• UniProt ID: P12272, Q53XY9
• Cytogenetics: 12p11.22
• Refseq Size: 1881
• Refseq ORF: 525
• Synonyms: BDE2; HHM; PLP; PTHR; PTHRP
• Summary: 'The protein encoded by this gene is a member of the parathyroid hormone family. This hormone, via its receptor, PTHR1, regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. It is responsible for most cases of humoral hypercalcemia of malignancy, and mutations in this gene are associated with brachydactyly type E2 (BDE2). Alternatively spliced transcript variants have been found for this gene. There is also evidence for alternative translation initiation from non-AUG (CUG and GUG) start sites, downstream of the initiator AUG codon, resulting in nuclear forms of this hormone. [provided by RefSeq, Nov 2013]'
• Protein Families: Druggable Genome, Secreted Protein