ARSA (NM_001085425) Human Mass Spec Standard
CAT#: PH313072
ARSA MS Standard C13 and N15-labeled recombinant protein (NP_001078894)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213072 |
Predicted MW | 53.81 kDa |
Protein Sequence |
>RC213072 representing NM_001085425
Red=Cloning site Green=Tags(s) MSMGAPRSLLLALAAGLAVARPPNIVLIFADDLGYGDLGCYGHPSSTTPNLDQLAAGGLRFTDFYVPVSL CTPSRAALLTGRLPVRMGMYPGVLVPSSRGGLPLEEVTVAEVLAARGYLTGMAGKWHLGVGPEGAFLPPH QGFHRFLGIPYSHDQGPCQNLTCFPPATPCDGGCDQGLVPIPLLANLSVEAQPPWLPGLEARYMAFAHDL MADAQRQDRPFFLYYASHHTHYPQFSGQSFAERSGRGPFGDSLMELDAAVGTLMTAIGDLGLLEETLVIF TADNGPETMRMSRGGCSGLLRCGKGTTYEGGVREPALAFWPGHIAPGVTHELASSLDLLPTLAALAGAPL PNVTLDGFDLSPLLLGTGKSPRQSLFFYPSYPDEVRGVFAVRTGKYKAHFFTQGSAHSDTTADPACHASS SLTAHEPPLLYDLSKDPGENYNLLGGVAGATPEVLQALKQLQLLKAQLDAAVTFGPSQVARGEDPALQIC CHPGCTPRPACCHCPDPHA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001078894 |
RefSeq Size | 1966 |
RefSeq ORF | 1527 |
Synonyms | ASA; MLD |
Locus ID | 410 |
UniProt ID | P15289, A0A0C4DFZ2 |
Cytogenetics | 22q13.33 |
Summary | 'The protein encoded by this gene hydrolyzes cerebroside sulfate to cerebroside and sulfate. Defects in this gene lead to metachromatic leucodystrophy (MLD), a progressive demyelination disease which results in a variety of neurological symptoms and ultimately death. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Dec 2010]' |
Protein Families | Druggable Genome |
Protein Pathways | Lysosome, Sphingolipid metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421293 | ARSA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC421294 | ARSA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC421295 | ARSA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC424697 | ARSA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425979 | ARSA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425980 | ARSA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425981 | ARSA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY421293 | Transient overexpression lysate of arylsulfatase A (ARSA), transcript variant 2 |
USD 495.00 |
|
LY421294 | Transient overexpression lysate of arylsulfatase A (ARSA), transcript variant 3 |
USD 495.00 |
|
LY421295 | Transient overexpression lysate of arylsulfatase A (ARSA), transcript variant 4 |
USD 495.00 |
|
LY424697 | Transient overexpression lysate of arylsulfatase A (ARSA), transcript variant 1 |
USD 325.00 |
|
LY425979 | Transient overexpression lysate of arylsulfatase A (ARSA), transcript variant 2 |
USD 325.00 |
|
LY425980 | Transient overexpression lysate of arylsulfatase A (ARSA), transcript variant 3 |
USD 325.00 |
|
LY425981 | Transient overexpression lysate of arylsulfatase A (ARSA), transcript variant 4 |
USD 325.00 |
|
PH304319 | ARSA MS Standard C13 and N15-labeled recombinant protein (NP_000478) |
USD 2,055.00 |
|
PH313161 | ARSA MS Standard C13 and N15-labeled recombinant protein (NP_001078896) |
USD 2,055.00 |
|
TP304319 | Recombinant protein of human arylsulfatase A (ARSA), transcript variant 1 |
USD 867.00 |
|
TP313072 | Purified recombinant protein of Homo sapiens arylsulfatase A (ARSA), transcript variant 2 |
USD 823.00 |
|
TP313161 | Purified recombinant protein of Homo sapiens arylsulfatase A (ARSA), transcript variant 4 |
USD 823.00 |
|
TP720270 | Recombinant protein of human arylsulfatase A (ARSA), transcript variant 1 |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review