ARSA (NM_001085425) Human Recombinant Protein
CAT#: TP313072
Purified recombinant protein of Homo sapiens arylsulfatase A (ARSA), transcript variant 2
View other "ARSA" proteins (20)
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC213072 representing NM_001085425
Red=Cloning site Green=Tags(s) MSMGAPRSLLLALAAGLAVARPPNIVLIFADDLGYGDLGCYGHPSSTTPNLDQLAAGGLRFTDFYVPVSL CTPSRAALLTGRLPVRMGMYPGVLVPSSRGGLPLEEVTVAEVLAARGYLTGMAGKWHLGVGPEGAFLPPH QGFHRFLGIPYSHDQGPCQNLTCFPPATPCDGGCDQGLVPIPLLANLSVEAQPPWLPGLEARYMAFAHDL MADAQRQDRPFFLYYASHHTHYPQFSGQSFAERSGRGPFGDSLMELDAAVGTLMTAIGDLGLLEETLVIF TADNGPETMRMSRGGCSGLLRCGKGTTYEGGVREPALAFWPGHIAPGVTHELASSLDLLPTLAALAGAPL PNVTLDGFDLSPLLLGTGKSPRQSLFFYPSYPDEVRGVFAVRTGKYKAHFFTQGSAHSDTTADPACHASS SLTAHEPPLLYDLSKDPGENYNLLGGVAGATPEVLQALKQLQLLKAQLDAAVTFGPSQVARGEDPALQIC CHPGCTPRPACCHCPDPHA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 51.9 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001078894 |
| Locus ID | 410 |
| UniProt ID | P15289, A0A0C4DFZ2 |
| Cytogenetics | 22q13.33 |
| Refseq Size | 1966 |
| Refseq ORF | 1527 |
| Synonyms | ASA; MLD |
| Summary | The protein encoded by this gene hydrolyzes cerebroside sulfate to cerebroside and sulfate. Defects in this gene lead to metachromatic leucodystrophy (MLD), a progressive demyelination disease which results in a variety of neurological symptoms and ultimately death. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Dec 2010] |
| Protein Families | Druggable Genome |
| Protein Pathways | Lysosome, Sphingolipid metabolism |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC421293 | ARSA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC421294 | ARSA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC421295 | ARSA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC424697 | ARSA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC425979 | ARSA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC425980 | ARSA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC425981 | ARSA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY421293 | Transient overexpression lysate of arylsulfatase A (ARSA), transcript variant 2 |
USD 665.00 |
|
| LY421294 | Transient overexpression lysate of arylsulfatase A (ARSA), transcript variant 3 |
USD 665.00 |
|
| LY421295 | Transient overexpression lysate of arylsulfatase A (ARSA), transcript variant 4 |
USD 665.00 |
|
| LY424697 | Transient overexpression lysate of arylsulfatase A (ARSA), transcript variant 1 |
USD 436.00 |
|
| LY425979 | Transient overexpression lysate of arylsulfatase A (ARSA), transcript variant 2 |
USD 396.00 |
|
| LY425980 | Transient overexpression lysate of arylsulfatase A (ARSA), transcript variant 3 |
USD 396.00 |
|
| LY425981 | Transient overexpression lysate of arylsulfatase A (ARSA), transcript variant 4 |
USD 396.00 |
|
| PH304319 | ARSA MS Standard C13 and N15-labeled recombinant protein (NP_000478) |
USD 2,055.00 |
|
| PH313072 | ARSA MS Standard C13 and N15-labeled recombinant protein (NP_001078894) |
USD 2,055.00 |
|
| PH313161 | ARSA MS Standard C13 and N15-labeled recombinant protein (NP_001078896) |
USD 2,055.00 |
|
| TP304319 | Recombinant protein of human arylsulfatase A (ARSA), transcript variant 1 |
USD 867.00 |
|
| TP313161 | Purified recombinant protein of Homo sapiens arylsulfatase A (ARSA), transcript variant 4 |
USD 823.00 |
|
| TP720270 | Recombinant protein of human arylsulfatase A (ARSA), transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China