HSD17B13 (NM_178135) Human Mass Spec Standard
CAT#: PH313132
HSD17B13 MS Standard C13 and N15-labeled recombinant protein (NP_835236)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213132 |
Predicted MW | 33.7 kDa |
Protein Sequence |
>RC213132 protein sequence
Red=Cloning site Green=Tags(s) MNIILEILLLLITIIYSYLESLVKFFIPQRRKSVAGEIVLITGAGHGIGRQTTYEFAKRQSILVLWDINK RGVEETAAECRKLGVTAHAYVVDCSNREEIYRSLNQVKKEVGDVTIVVNNAGTVYPADLLSTKDEEITKT FEVNILGHFWITKALLPSMMERNHGHIVTVASVCGHEGIPYLIPYCSSKFAAVGFHRGLTSELQALGKTG IKTSCLCPVFVNTGFTKNPSTRLWPVLETDEVVRSLIDGILTNKKMIFVPSYINIFLRLQKFLPERASAI LNRMQNIQFEAVVGHKIKMK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_835236 |
RefSeq Size | 2397 |
RefSeq ORF | 900 |
Synonyms | HMFN0376; NIIL497; SCDR9; SDR16C3 |
Locus ID | 345275 |
UniProt ID | Q7Z5P4 |
Cytogenetics | 4q22.1 |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405941 | HSD17B13 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC427863 | HSD17B13 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC440268 | HSD17B13, transcript variant D, HEK 293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC440269 | HSD17B13, transcript variant C, HEK 293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY405941 | Transient overexpression lysate of hydroxysteroid (17-beta) dehydrogenase 13 (HSD17B13), transcript variant A |
USD 325.00 |
|
LY427863 | Transient overexpression lysate of hydroxysteroid (17-beta) dehydrogenase 13 (HSD17B13), transcript variant B |
USD 325.00 |
|
LY440268 | Transient overexpression lysate of human hydroxysteroid (17-beta) dehydrogenase 13 (HSD17B13), transcript variant D |
USD 325.00 |
|
LY440269 | Transient overexpression lysate of human hydroxysteroid (17-beta) dehydrogenase 13 (HSD17B13), transcript variant C |
USD 325.00 |
|
TP313132 | Recombinant protein of human hydroxysteroid (17-beta) dehydrogenase 13 (HSD17B13), transcript variant A |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review