HSD17B13 (NM_178135) Human Recombinant Protein

CAT#: TP313132

Recombinant protein of human hydroxysteroid (17-beta) dehydrogenase 13 (HSD17B13), transcript variant A

Product Images

HSD17B13 enzymatic activity with 75μM β-estradiol as a substrate, measured by NADH production (indicated by luminescence).

• 

  Coomassie blue staining of purified HSD17B13 protein (Cat# TP313132). The protein was produced from HEK293T cells transfected with HSD17B13 cDNA clone (Cat# RC213132) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC213132 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNIILEILLLLITIIYSYLESLVKFFIPQRRKSVAGEIVLITGAGHGIGRQTTYEFAKRQSILVLWDINK
  RGVEETAAECRKLGVTAHAYVVDCSNREEIYRSLNQVKKEVGDVTIVVNNAGTVYPADLLSTKDEEITKT
  FEVNILGHFWITKALLPSMMERNHGHIVTVASVCGHEGIPYLIPYCSSKFAAVGFHRGLTSELQALGKTG
  IKTSCLCPVFVNTGFTKNPSTRLWPVLETDEVVRSLIDGILTNKKMIFVPSYINIFLRLQKFLPERASAI
  LNRMQNIQFEAVVGHKIKMK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 33.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_835236
• Locus ID: 345275
• UniProt ID: Q7Z5P4
• Cytogenetics: 4q22.1
• Refseq Size: 2397
• Refseq ORF: 900
• Synonyms: HMFN0376; NIIL497; SCDR9; SDR16C3
• Protein Families: Druggable Genome, Secreted Protein, Transmembrane