C2orf88 (NM_032321) Human Mass Spec Standard
CAT#: PH313211
C2orf88 MS Standard C13 and N15-labeled recombinant protein (NP_115697)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213211 |
Predicted MW | 10.8 kDa |
Protein Sequence |
>RC213211 representing NM_032321
Red=Cloning site Green=Tags(s) MGCMKSKQTFPFPTIYEGEKQHESEEPFMPEERCLPRMASPVNVKEEVKEPPGTNIVILEYAHRLSQDIL CDALQQWACNNIKYHDIPYIESEGP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_115697 |
RefSeq Size | 705 |
RefSeq ORF | 285 |
Synonyms | smAKAP |
Locus ID | 84281 |
UniProt ID | Q9BSF0 |
Cytogenetics | 2q32.2 |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403155 | C2orf88 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC420957 | C2orf88 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC420958 | C2orf88 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC420959 | C2orf88 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425764 | C2orf88 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425765 | C2orf88 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403155 | Transient overexpression lysate of chromosome 2 open reading frame 88 (C2orf88), transcript variant 4 |
USD 396.00 |
|
LY420957 | Transient overexpression lysate of chromosome 2 open reading frame 88 (C2orf88), transcript variant 1 |
USD 396.00 |
|
LY420958 | Transient overexpression lysate of chromosome 2 open reading frame 88 (C2orf88), transcript variant 3 |
USD 396.00 |
|
LY420959 | Transient overexpression lysate of chromosome 2 open reading frame 88 (C2orf88), transcript variant 2 |
USD 396.00 |
|
LY425764 | Transient overexpression lysate of chromosome 2 open reading frame 88 (C2orf88), transcript variant 3 |
USD 396.00 |
|
LY425765 | Transient overexpression lysate of chromosome 2 open reading frame 88 (C2orf88), transcript variant 2 |
USD 396.00 |
|
PH302987 | C2orf88 MS Standard C13 and N15-labeled recombinant protein (NP_001035984) |
USD 2,055.00 |
|
PH313362 | C2orf88 MS Standard C13 and N15-labeled recombinant protein (NP_001035985) |
USD 2,055.00 |
|
PH324360 | C2orf88 MS Standard C13 and N15-labeled recombinant protein (NP_001035986) |
USD 2,055.00 |
|
TP302987 | Recombinant protein of human hypothetical protein MGC13057 (MGC13057), transcript variant 1 |
USD 823.00 |
|
TP313211 | Recombinant protein of human hypothetical protein MGC13057 (MGC13057), transcript variant 4 |
USD 823.00 |
|
TP313362 | Purified recombinant protein of Homo sapiens hypothetical protein MGC13057 (MGC13057), transcript variant 3 |
USD 823.00 |
|
TP324360 | Purified recombinant protein of Homo sapiens hypothetical protein MGC13057 (MGC13057), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review