C2orf88 (NM_001042520) Human Recombinant Protein
CAT#: TP313362
Purified recombinant protein of Homo sapiens hypothetical protein MGC13057 (MGC13057), transcript variant 3
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213362 protein sequence
Red=Cloning site Green=Tags(s) MGCMKSKQTFPFPTIYEGEKQHESEEPFMPEERCLPRMASPVNVKEEVKEPPGTNIVILEYAHRLSQDIL CDALQQWACNNIKYHDIPYIESEGP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10.8 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001035985 |
Locus ID | 84281 |
UniProt ID | Q9BSF0 |
Cytogenetics | 2q32.2 |
Refseq Size | 4007 |
Refseq ORF | 285 |
Synonyms | smAKAP |
Summary | Binds to type I regulatory subunits of protein kinase A (PKA-RI) and may anchor/target them to the plasma membrane.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403155 | C2orf88 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC420957 | C2orf88 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC420958 | C2orf88 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC420959 | C2orf88 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425764 | C2orf88 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425765 | C2orf88 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY403155 | Transient overexpression lysate of chromosome 2 open reading frame 88 (C2orf88), transcript variant 4 |
USD 325.00 |
|
LY420957 | Transient overexpression lysate of chromosome 2 open reading frame 88 (C2orf88), transcript variant 1 |
USD 325.00 |
|
LY420958 | Transient overexpression lysate of chromosome 2 open reading frame 88 (C2orf88), transcript variant 3 |
USD 325.00 |
|
LY420959 | Transient overexpression lysate of chromosome 2 open reading frame 88 (C2orf88), transcript variant 2 |
USD 325.00 |
|
LY425764 | Transient overexpression lysate of chromosome 2 open reading frame 88 (C2orf88), transcript variant 3 |
USD 325.00 |
|
LY425765 | Transient overexpression lysate of chromosome 2 open reading frame 88 (C2orf88), transcript variant 2 |
USD 325.00 |
|
PH302987 | C2orf88 MS Standard C13 and N15-labeled recombinant protein (NP_001035984) |
USD 2,055.00 |
|
PH313211 | C2orf88 MS Standard C13 and N15-labeled recombinant protein (NP_115697) |
USD 2,055.00 |
|
PH313362 | C2orf88 MS Standard C13 and N15-labeled recombinant protein (NP_001035985) |
USD 2,055.00 |
|
PH324360 | C2orf88 MS Standard C13 and N15-labeled recombinant protein (NP_001035986) |
USD 2,055.00 |
|
TP302987 | Recombinant protein of human hypothetical protein MGC13057 (MGC13057), transcript variant 1 |
USD 823.00 |
|
TP313211 | Recombinant protein of human hypothetical protein MGC13057 (MGC13057), transcript variant 4 |
USD 823.00 |
|
TP324360 | Purified recombinant protein of Homo sapiens hypothetical protein MGC13057 (MGC13057), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review