C2orf88 (NM_001042520) Human Recombinant Protein

CAT#: TP313362

Purified recombinant protein of Homo sapiens hypothetical protein MGC13057 (MGC13057), transcript variant 3

Product Images

Coomassie blue staining of purified C2orf88 protein (Cat# TP313362). The protein was produced from HEK293T cells transfected with C2orf88 cDNA clone (Cat# RC213362) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC213362 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGCMKSKQTFPFPTIYEGEKQHESEEPFMPEERCLPRMASPVNVKEEVKEPPGTNIVILEYAHRLSQDIL
  CDALQQWACNNIKYHDIPYIESEGP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 10.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001035985
• Locus ID: 84281
• UniProt ID: Q9BSF0
• Cytogenetics: 2q32.2
• Refseq Size: 4007
• Refseq ORF: 285
• Synonyms: smAKAP
• Summary: Binds to type I regulatory subunits of protein kinase A (PKA-RI) and may anchor/target them to the plasma membrane.[UniProtKB/Swiss-Prot Function]