STAR (NM_001007243) Human Mass Spec Standard

CAT#: PH313299

STAR MS Standard C13 and N15-labeled recombinant protein (NP_001007244)

Product Images

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC213299
• Predicted MW: 29.9 kDa
• Protein Sequence:
  Sequence Link

  >RC213299 representing NM_001007243
  Red=Cloning site Green=Tags(s)
  
  MLLATFKLCAGSSYRHMRNMKGLRQQAVMAISQELNRRALGGPTPSTWINQVRRRSSLLGSRLEETLYSD
  QELAYLQQGEEAMQKALGILSNQEGWKKESQQDNGDKVMSKVVPDVGKVFRLEVVVDQPMERLYEELVER
  MEAMGEWNPNVKEIKVLQKIGGPRDFVSVRCAKRRGSTCVLAGMATDFGNMPEQKGVIRAEHGPTCMVLH
  PLAGSPSKTKLTWLLSIDLKGWLPKSIINQVLSQTQVDFANHLRKRLESHPASEARC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001007244
• RefSeq Size: 2641
• RefSeq ORF: 801
• Synonyms: cholesterol trafficker; mitochondrial steroid acute regulatory protein; StAR-related lipid transfer (START) domain containing 1; STARD1; START domain containing 1; steroid acute regulatory protein; steroidogenic acute regula; steroidogenic acute regulator
• Locus ID: 6770
• Cytogenetics: 8p11.23
• Summary: The protein encoded by this gene plays a key role in the acute regulation of steroid hormone synthesis by enhancing the conversion of cholesterol into pregnenolone. This protein permits the cleavage of cholesterol into pregnenolone by mediating the transport of cholesterol from the outer mitochondrial membrane to the inner mitochondrial membrane. Mutations in this gene are a cause of congenital lipoid adrenal hyperplasia (CLAH), also called lipoid CAH. A pseudogene of this gene is located on chromosome 13. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome