STAR (NM_000349) Human Recombinant Protein

CAT#: TP303803

Purified recombinant protein of Homo sapiens steroidogenic acute regulatory protein (STAR), nuclear gene encoding mitochondrial protein, transcript variant 1

Product Images

Coomassie blue staining of purified STAR protein (Cat# TP303803). The protein was produced from HEK293T cells transfected with STAR cDNA clone (Cat# RC203803) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203803 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLLATFKLCAGSSYRHMRNMKGLRQQAVMAISQELNRRALGGPTPSTWINQVRRRSSLLGSRLEETLYSD
  QELAYLQQGEEAMQKALGILSNQEGWKKESQQDNGDKVMSKVVPDVGKVFRLEVVVDQPMERLYEELVER
  MEAMGEWNPNVKEIKVLQKIGKDTFITHELAAEAAGNLVGPRDFVSVRCAKRRGSTCVLAGMATDFGNMP
  EQKGVIRAEHGPTCMVLHPLAGSPSKTKLTWLLSIDLKGWLPKSIINQVLSQTQVDFANHLRKRLESHPA
  SEARC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 31.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000340
• Locus ID: 6770
• UniProt ID: P49675, Q6IBK0
• Cytogenetics: 8p11.23
• Refseq Size: 2695
• Refseq ORF: 855
• Synonyms: STARD1
• Summary: The protein encoded by this gene plays a key role in the acute regulation of steroid hormone synthesis by enhancing the conversion of cholesterol into pregnenolone. This protein permits the cleavage of cholesterol into pregnenolone by mediating the transport of cholesterol from the outer mitochondrial membrane to the inner mitochondrial membrane. Mutations in this gene are a cause of congenital lipoid adrenal hyperplasia (CLAH), also called lipoid CAH. A pseudogene of this gene is located on chromosome 13. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome