NY-ESO-1 (CTAG1B) (NM_001327) Human Mass Spec Standard

CAT#: PH313318

CTAG1B (NY-ESO-1) MS Standard C13 and N15-labeled recombinant protein (NP_001318)

Product Images

Coomassie blue staining of purified CTAG1B protein (Cat# TP313318). The protein was produced from HEK293T cells transfected with CTAG1B cDNA clone (Cat# RC213318) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC213318
• Predicted MW: 17.8 kDa
• Protein Sequence:
  Sequence Link

  >RC213318 representing NM_001327
  Red=Cloning site Green=Tags(s)
  
  MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAAS
  GLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAA
  DHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001318
• RefSeq Size: 806
• RefSeq ORF: 540
• Synonyms: CT6.1; CTAG; CTAG1; ESO1; LAGE-2; LAGE2B; NY-ESO-1
• Locus ID: 1485
• UniProt ID: P78358
• Cytogenetics: Xq28
• Summary: 'The protein encoded by this gene is an antigen that is overexpressed in many cancers but that is also expressed in normal testis. This gene is found in a duplicated region of the X-chromosome and therefore has a neighboring gene of identical sequence. [provided by RefSeq, Jan 2012]'
• Protein Families: Druggable Genome