NY-ESO-1 (CTAG1B) (NM_001327) Human Recombinant Protein
CAT#: TP313318
Recombinant protein of human cancer/testis antigen 1B (CTAG1B/NY-ESO-1)
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC213318 representing NM_001327
Red=Cloning site Green=Tags(s) MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAAS GLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAA DHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 17.8 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Bioactivity | ELISA capture for autoantibodies (PMID: 27323861) ELISA capture for autoantibodies (PMID: 27793776) |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001318 |
| Locus ID | 1485 |
| UniProt ID | P78358 |
| Cytogenetics | Xq28 |
| Refseq Size | 806 |
| Refseq ORF | 540 |
| Synonyms | CT6.1; CTAG; CTAG1; ESO1; LAGE-2; LAGE2B; NY-ESO-1 |
| Summary | The protein encoded by this gene is an antigen that is overexpressed in many cancers but that is also expressed in normal testis. This gene is found in a duplicated region of the X-chromosome and therefore has a neighboring gene of identical sequence. [provided by RefSeq, Jan 2012] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400527 | CTAG1B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400527 | Transient overexpression lysate of cancer/testis antigen 1B (CTAG1B/NY-ESO-1) |
USD 436.00 |
|
| PH313318 | CTAG1B (NY-ESO-1) MS Standard C13 and N15-labeled recombinant protein (NP_001318) |
USD 2,055.00 |
|
| TP710205 | Purified recombinant protein of Homo sapiens cancer/testis antigen 1B (CTAG1B), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China