NY-ESO-1 (CTAG1B) (NM_001327) Human Recombinant Protein

CAT#: TP313318

Recombinant protein of human cancer/testis antigen 1B (CTAG1B/NY-ESO-1)

Product Images

Coomassie blue staining of purified CTAG1B protein (Cat# TP313318). The protein was produced from HEK293T cells transfected with CTAG1B cDNA clone (Cat# RC213318) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC213318 representing NM_001327
  Red=Cloning site Green=Tags(s)
  
  MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAAS
  GLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAA
  DHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 17.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: ELISA capture for autoantibodies (PMID: 27323861)
  ELISA capture for autoantibodies (PMID: 27793776)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001318
• Locus ID: 1485
• UniProt ID: P78358
• Cytogenetics: Xq28
• Refseq Size: 806
• Refseq ORF: 540
• Synonyms: CT6.1; CTAG; CTAG1; ESO1; LAGE-2; LAGE2B; NY-ESO-1
• Summary: The protein encoded by this gene is an antigen that is overexpressed in many cancers but that is also expressed in normal testis. This gene is found in a duplicated region of the X-chromosome and therefore has a neighboring gene of identical sequence. [provided by RefSeq, Jan 2012]
• Protein Families: Druggable Genome