SAR1B (NM_001033503) Human Mass Spec Standard

CAT#: PH313692

SAR1B MS Standard C13 and N15-labeled recombinant protein (NP_001028675)

Product Images

Coomassie blue staining of purified SAR1B protein (Cat# TP313692). The protein was produced from HEK293T cells transfected with SAR1B cDNA clone (Cat# RC213692) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC213692
• Predicted MW: 22.4 kDa
• Protein Sequence:
  Sequence Link

  >RC213692 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSFIFDWIYSGFSSVLQFLGLYKKTGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSEELTIAGMT
  FTTFDLGGHVQARRVWKNYLPAINGIVFLVDCADHERLLESKEELDSLMTDETIANVPILILGNKIDRPE
  AISEERLREMFGLYGQTTGKGSISLKELNARPLEVFMCSVLKRQGYGEGFRWMAQYID
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001028675
• RefSeq Size: 6651
• RefSeq ORF: 594
• Synonyms: ANDD; CMRD; GTBPB; SARA2
• Locus ID: 51128
• UniProt ID: Q9Y6B6
• Cytogenetics: 5q31.1
• Summary: The protein encoded by this gene is a small GTPase that acts as a homodimer. The encoded protein is activated by the guanine nucleotide exchange factor PREB and is involved in protein transport from the endoplasmic reticulum to the Golgi. This protein is part of the COPII coat complex. Defects in this gene are a cause of chylomicron retention disease (CMRD), also known as Anderson disease (ANDD). Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Mar 2010]