SERPINA11 (NM_001080451) Human Mass Spec Standard

CAT#: PH313870

SERPINA11 MS Standard C13 and N15-labeled recombinant protein (NP_001073920)

Product Images

Coomassie blue staining of purified SERPINA11 protein (Cat# TP313870). The protein was produced from HEK293T cells transfected with SERPINA11 cDNA clone (Cat# RC213870) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC213870
• Predicted MW: 46.8 kDa
• Protein Sequence:
  Sequence Link

  >RC213870 representing NM_001080451
  Red=Cloning site Green=Tags(s)
  
  MGPAWLWLLGTGILASVHCQPLLAHGDKSLQGPQPPRHQLSEPAPAYHRITPTITNFALRLYKELAADAP
  GNIFFSPVSISTTLALLSLGAQANTSALILEGLGFNLTETPEADIHQGFRSLLHTLALPSPKLELKVGNS
  LFLDKRLKPRQHYLDSIKELYGAFAFSANFTDSVTTGRQINDYLRRQTYGQVVDCLPEFSQDTFMVLANY
  IFFKAKWKHPFSRYQTQKQESFFVDERTSLQVPMMHQKEMHRFLYDQDLACTVLQIEYRGNALALLVLPD
  PGKMKQVEAALQPQTLRKWGQLLLPSLLDLHLPRFSISGTYNLEDILPQIGLTNILNLEADFSGVTGQLN
  KTISKVSHKAMVDMSEKGTEAGAASGLLSQPPSLNTMSDPHAHFNRPFLLLLWEVTTQSLLFLGKVVNPV
  AG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001073920
• RefSeq Size: 1471
• RefSeq ORF: 1266
• Synonyms: antiproteinase-like 2; serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 11; serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 11
• Locus ID: 256394
• UniProt ID: Q86U17
• Cytogenetics: 14q32.13
• Protein Families: Druggable Genome, Secreted Protein