Cardiac Troponin T (TNNT2) (NM_000364) Human Mass Spec Standard

CAT#: PH314180

TNNT2 MS Standard C13 and N15-labeled recombinant protein (NP_000355)

Product Images

Coomassie blue staining of purified TNNT2 protein (Cat# TP314180). The protein was produced from HEK293T cells transfected with TNNT2 cDNA clone (Cat# RC214180) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC214180
• Predicted MW: 35.4 kDa
• Protein Sequence:
  Sequence Link

  >RC214180 representing NM_000364
  Red=Cloning site Green=Tags(s)
  
  MSDIEEVVEEYEEEEQEEAAVEEEEDWREDEDEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDGPM
  EESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHFENRKKEEEELVSLKDRIERR
  RAERAEQQRIRNEREKERQNRLAEERARREEEENRRKAEDEARKKKALSNMMHFGGYIQKTERKSGKRQT
  EREKKKKILAERRKVLAIDHLNEDQLREKAKELWQSIYNLEAEKFDLQEKFKQQKYEINVLRNRINDNQK
  VSKTRGKAKVTGRWK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000355
• RefSeq Size: 1153
• RefSeq ORF: 885
• Synonyms: CMD1D; CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
• Locus ID: 7139
• UniProt ID: P45379
• Cytogenetics: 1q32.1
• Summary: 'The protein encoded by this gene is the tropomyosin-binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. Mutations in this gene have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy. Transcripts for this gene undergo alternative splicing that results in many tissue-specific isoforms, however, the full-length nature of some of these variants has not yet been determined. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome
• Protein Pathways: Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM)