Cardiac Troponin T (TNNT2) (NM_001001432) Human Mass Spec Standard
CAT#: PH314299
TNNT2 MS Standard C13 and N15-labeled recombinant protein (NP_001001432)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214299 |
Predicted MW | 33.8 kDa |
Protein Sequence |
>RC214299 representing NM_001001432
Red=Cloning site Green=Tags(s) MSDIEEVVEEYEEEEQEEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDGPMEESKPKPRSFMPNLV PPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHFENRKKEEEELVSLKDRIERRRAERAEQQRIRNERE KERQNRLAEERARREEEENRRKAEDEARKKKALSNMMHFGGYIQKAQTERKSGKRQTEREKKKKILAERR KVLAIDHLNEDQLREKAKELWQSIYNLEAEKFDLQEKFKQQKYEINVLRNRINDNQKVSKTRGKAKVTGR WK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001001432 |
RefSeq Size | 1114 |
RefSeq ORF | 846 |
Synonyms | CMD1D; CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC |
Locus ID | 7139 |
UniProt ID | P45379, A0A0A0MRJ5, Q15607 |
Cytogenetics | 1q32.1 |
Summary | 'The protein encoded by this gene is the tropomyosin-binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. Mutations in this gene have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy. Transcripts for this gene undergo alternative splicing that results in many tissue-specific isoforms, however, the full-length nature of some of these variants has not yet been determined. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome |
Protein Pathways | Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM) |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400130 | TNNT2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC424349 | TNNT2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC424350 | TNNT2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC424351 | TNNT2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425027 | TNNT2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425028 | TNNT2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400130 | Transient overexpression lysate of troponin T type 2 (cardiac) (TNNT2), transcript variant 1 |
USD 325.00 |
|
LY424349 | Transient overexpression lysate of troponin T type 2 (cardiac) (TNNT2), transcript variant 2 |
USD 325.00 |
|
LY424350 | Transient overexpression lysate of troponin T type 2 (cardiac) (TNNT2), transcript variant 3 |
USD 325.00 |
|
LY424351 | Transient overexpression lysate of troponin T type 2 (cardiac) (TNNT2), transcript variant 4 |
USD 325.00 |
|
LY425027 | Transient overexpression lysate of troponin T type 2 (cardiac) (TNNT2), transcript variant 2 |
USD 325.00 |
|
LY425028 | Transient overexpression lysate of troponin T type 2 (cardiac) (TNNT2), transcript variant 4 |
USD 325.00 |
|
PH301218 | TNNT2 MS Standard C13 and N15-labeled recombinant protein (NP_001001431) |
USD 2,055.00 |
|
PH314180 | TNNT2 MS Standard C13 and N15-labeled recombinant protein (NP_000355) |
USD 2,055.00 |
|
PH314241 | TNNT2 MS Standard C13 and N15-labeled recombinant protein (NP_001001430) |
USD 2,055.00 |
|
TP301218 | Recombinant protein of human troponin T type 2 (cardiac) (TNNT2), transcript variant 3 |
USD 823.00 |
|
TP314180 | Recombinant protein of human troponin T type 2 (cardiac) (TNNT2), transcript variant 1 |
USD 748.00 |
|
TP314241 | Purified recombinant protein of Homo sapiens troponin T type 2 (cardiac) (TNNT2), transcript variant 2 |
USD 748.00 |
|
TP314299 | Purified recombinant protein of Homo sapiens troponin T type 2 (cardiac) (TNNT2), transcript variant 4 |
USD 748.00 |
|
TP750172 | Purified recombinant protein of Human troponin T type 2 (cardiac) (TNNT2), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50 ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review