RBP1 (NM_002899) Human Mass Spec Standard
CAT#: PH314515
RBP1 MS Standard C13 and N15-labeled recombinant protein (NP_002890)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC214515 |
| Predicted MW | 15.7 kDa |
| Protein Sequence |
>RC214515 representing NM_002899
Red=Cloning site Green=Tags(s) MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKE FEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_002890 |
| RefSeq Size | 720 |
| RefSeq ORF | 405 |
| Synonyms | CRABP-I; CRBP; CRBP1; CRBPI; RBPC |
| Locus ID | 5947 |
| UniProt ID | P09455, A0A0A0MQT0 |
| Cytogenetics | 3q23 |
| Summary | 'This gene encodes the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]' |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401017 | RBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY401017 | Transient overexpression lysate of retinol binding protein 1, cellular (RBP1), transcript variant 1 |
USD 436.00 |
|
| TP314515 | Recombinant protein of human retinol binding protein 1, cellular (RBP1), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China