beta Catenin (CTNNB1) (NM_001098210) Human Mass Spec Standard
CAT#: PH314557
CTNNB1 MS Standard C13 and N15-labeled recombinant protein (NP_001091680)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC214557 |
| Predicted MW | 85.3 kDa |
| Protein Sequence |
>RC214557 representing NM_001098210
Red=Cloning site Green=Tags(s) MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGF SQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLI NYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVET ARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQ KMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVC SSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG LPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQF VEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEA IEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDI GAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGD SNQLAWFDTDL myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_001091680 |
| RefSeq Size | 3256 |
| RefSeq ORF | 2343 |
| Synonyms | armadillo; CTNNB; EVR7; MRD19; NEDSDV |
| Locus ID | 1499 |
| UniProt ID | P35222, A0A024R2Q3 |
| Cytogenetics | 3p22.1 |
| Summary | 'The protein encoded by this gene is part of a complex of proteins that constitute adherens junctions (AJs). AJs are necessary for the creation and maintenance of epithelial cell layers by regulating cell growth and adhesion between cells. The encoded protein also anchors the actin cytoskeleton and may be responsible for transmitting the contact inhibition signal that causes cells to stop dividing once the epithelial sheet is complete. Finally, this protein binds to the product of the APC gene, which is mutated in adenomatous polyposis of the colon. Mutations in this gene are a cause of colorectal cancer (CRC), pilomatrixoma (PTR), medulloblastoma (MDB), and ovarian cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2016]' |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors |
| Protein Pathways | Adherens junction, Arrhythmogenic right ventricular cardiomyopathy (ARVC), Basal cell carcinoma, Colorectal cancer, Endometrial cancer, Focal adhesion, Leukocyte transendothelial migration, Melanogenesis, Pathogenic Escherichia coli infection, Pathways in cancer, Prostate cancer, Thyroid cancer, Tight junction, Wnt signaling pathway |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419662 | CTNNB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC420557 | CTNNB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC420558 | CTNNB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC426005 | CTNNB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC426006 | CTNNB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LY419662 | Transient overexpression lysate of catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), transcript variant 1 |
USD 436.00 |
|
| LY420557 | Transient overexpression lysate of catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), transcript variant 2 |
USD 665.00 |
|
| LY420558 | Transient overexpression lysate of catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), transcript variant 3 |
USD 665.00 |
|
| LY426005 | Transient overexpression lysate of catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), transcript variant 2 |
USD 605.00 |
|
| LY426006 | Transient overexpression lysate of catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), transcript variant 3 |
USD 605.00 |
|
| PH308947 | CTNNB1 MS Standard C13 and N15-labeled recombinant protein (NP_001895) |
USD 2,055.00 |
|
| PH312056 | CTNNB1 MS Standard C13 and N15-labeled recombinant protein (NP_001091679) |
USD 2,055.00 |
|
| TP308947 | Recombinant protein of human catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1) |
USD 867.00 |
|
| TP312056 | Recombinant protein of human catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1) |
USD 748.00 |
|
| TP314557 | Recombinant protein of human catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1) |
USD 748.00 |
|
| TP710027 | Recombinant protein of human human catenin (cadherin-associated protein), beta 1(CTNNB1), full length, with C-terminal DDK tag, expressed in sf9 cells |
USD 425.00 |
|
| TP710124 | Recombinant protein of human human catenin (cadherin-associated protein), beta 1(CTNNB1), full length, with N-terminal His tag, expressed in sf9 cells |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China