Cardiac Troponin I (TNNI3) (NM_000363) Human Mass Spec Standard
CAT#: PH314740
TNNI3 MS Standard C13 and N15-labeled recombinant protein (NP_000354)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC214740 |
| Predicted MW | 23.8 kDa |
| Protein Sequence |
>RC214740 representing NM_000363
Red=Cloning site Green=Tags(s) MADGSSDAAREPRPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLKTLLLQIAKQELEREAEERRG EKGRALSTRCQPLELAGLGFAELQDLCRQLHARVDKVDEERYDIEAKVTKNITEIADLTQKIFDLRGKFK RPTLRRVRISADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNIDALSGMEGRKKKFES myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_000354 |
| RefSeq Size | 2073 |
| RefSeq ORF | 630 |
| Synonyms | CMD1FF; CMD2A; CMH7; cTnI; RCM1; TNNC1 |
| Locus ID | 7137 |
| UniProt ID | P19429, Q6FGX2 |
| Cytogenetics | 19q13.42 |
| Summary | 'Troponin I (TnI), along with troponin T (TnT) and troponin C (TnC), is one of 3 subunits that form the troponin complex of the thin filaments of striated muscle. TnI is the inhibitory subunit; blocking actin-myosin interactions and thereby mediating striated muscle relaxation. The TnI subfamily contains three genes: TnI-skeletal-fast-twitch, TnI-skeletal-slow-twitch, and TnI-cardiac. This gene encodes the TnI-cardiac protein and is exclusively expressed in cardiac muscle tissues. Mutations in this gene cause familial hypertrophic cardiomyopathy type 7 (CMH7) and familial restrictive cardiomyopathy (RCM). Troponin I is useful in making a diagnosis of heart failure, and of ischemic heart disease. An elevated level of troponin is also now used as indicator of acute myocardial injury in patients hospitalized with moderate/severe Coronavirus Disease 2019 (COVID-19). Such elevation has also been associated with higher risk of mortality in cardiovascular disease patients hospitalized due to COVID-19. [provided by RefSeq, Aug 2020]' |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Stem cell - Pluripotency |
| Protein Pathways | Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM) |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424766 | TNNI3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LY424766 | Transient overexpression lysate of troponin I type 3 (cardiac) (TNNI3) |
USD 665.00 |
|
| TP314740 | Recombinant protein of human troponin I type 3 (cardiac) (TNNI3) |
USD 788.00 |
|
| TP710224 | Purified recombinant protein of Human troponin I type 3 (cardiac) (TNNI3), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China