ROR1 (NM_005012) Human Mass Spec Standard
CAT#: PH314967
ROR1 MS Standard C13 and N15-labeled recombinant protein (NP_005003)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214967 |
Predicted MW | 104.1 kDa |
Protein Sequence |
>RC214967 representing NM_005012
Red=Cloning site Green=Tags(s) MHRPRRRGTRPPLLALLAALLLAARGAAAQETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTS LGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVV SSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIG TSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLP NCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTAL RFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKMEILYILVPSVAIPLAIAL LFFFICVCRNNQKSSSAPVQRQPKHVRGQNVEMSMLNAYKPKSKAKELPLSAVRFMEELGECAFGKIYKG HLYLPGMDHAQLVAIKTLKDYNNPQQWMEFQQEASLMAELHHPNIVCLLGAVTQEQPVCMLFEYINQGDL HEFLIMRSPHSDVGCSSDEDGTVKSSLDHGDFLHIAIQIAAGMEYLSSHFFVHKDLAARNILIGEQLHVK ISDLGLSREIYSADYYRVQSKSLLPIRWMPPEAIMYGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQE VIEMVRKRQLLPCSEDCPPRMYSLMTECWNEIPSRRPRFKDIHVRLRSWEGLSSHTSSTTPSGGNATTQT TSLSASPVSNLSNPRYPNYMFPSQGITPQGQIAGFIGPPIPQNQRFIPINGYPIPPGYAAFPAAHYQPTG PPRVIQHCPPPKSRSPSSASGSTSTGHVTSLPSSGSNQEANIPLLPHMSIPNHPGGMGITVFGNKSQKPY KIDSKQASLLGDANIHGHTESMISAEL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005003 |
RefSeq Size | 3358 |
RefSeq ORF | 2811 |
Synonyms | dJ537F10.1; NTRKR1 |
Locus ID | 4919 |
UniProt ID | Q01973 |
Cytogenetics | 1p31.3 |
Summary | 'This gene encodes a receptor tyrosine kinase-like orphan receptor that modulates neurite growth in the central nervous system. The encoded protein is a glycosylated type I membrane protein that belongs to the ROR subfamily of cell surface receptors. It is a pseudokinase that lacks catalytic activity and may interact with the non-canonical Wnt signalling pathway. This gene is highly expressed during early embryonic development but expressed at very low levels in adult tissues. Increased expression of this gene is associated with B-cell chronic lymphocytic leukaemia. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jun 2012]' |
Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401558 | ROR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC421225 | ROR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401558 | Transient overexpression lysate of receptor tyrosine kinase-like orphan receptor 1 (ROR1), transcript variant 1 |
USD 605.00 |
|
LY421225 | Transient overexpression lysate of receptor tyrosine kinase-like orphan receptor 1 (ROR1), transcript variant 2 |
USD 396.00 |
|
PH324765 | ROR1 MS Standard C13 and N15-labeled recombinant protein (NP_001077061) |
USD 2,055.00 |
|
TP314967 | Recombinant protein of human receptor tyrosine kinase-like orphan receptor 1 (ROR1), transcript variant 1 |
USD 788.00 |
|
TP324765 | Recombinant protein of human receptor tyrosine kinase-like orphan receptor 1 (ROR1), transcript variant 2 |
USD 748.00 |
|
TP700158 | Purified recombinant protein of Homo sapiens receptor tyrosine kinase-like orphan receptor 1 (ROR1), transcript variant 1, residue 30-406 aa, expressed in HEK293 cells. |
USD 748.00 |
|
TP700159 | Purified recombinant protein of Human receptor tyrosine kinase-like orphan receptor 1 (ROR1), transcript variant 2, with C-terminal DDK/His tag, expressed in human cells |
USD 748.00 |
|
TP700184 | Purified recombinant protein of Homo sapiens receptor tyrosine kinase-like orphan receptor 1 (ROR1), transcript variant 1, residue 30-406 aa, expressed in HEK293 cells, with Fc tag |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review