ROR1 (NM_001083592) Human Mass Spec Standard

CAT#: PH324765

ROR1 MS Standard C13 and N15-labeled recombinant protein (NP_001077061)

Product Images

Coomassie blue staining of purified ROR1 protein (Cat# TP324765). The protein was produced from HEK293T cells transfected with ROR1 cDNA clone (Cat# RC224765) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC224765
• Predicted MW: 43.6 kDa
• Protein Sequence:
  Sequence Link

  >RC224765 representing NM_001083592
  Red=Cloning site Green=Tags(s)
  
  MHRPRRRGTRPPLLALLAALLLAARGAAAQETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTS
  LGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVV
  SSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIG
  TSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLP
  NCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTAL
  RFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACGK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001077061
• RefSeq Size: 2303
• RefSeq ORF: 1179
• Synonyms: dJ537F10.1; NTRKR1
• Locus ID: 4919
• UniProt ID: Q01973
• Cytogenetics: 1p31.3
• Summary: 'This gene encodes a receptor tyrosine kinase-like orphan receptor that modulates neurite growth in the central nervous system. The encoded protein is a glycosylated type I membrane protein that belongs to the ROR subfamily of cell surface receptors. It is a pseudokinase that lacks catalytic activity and may interact with the non-canonical Wnt signalling pathway. This gene is highly expressed during early embryonic development but expressed at very low levels in adult tissues. Increased expression of this gene is associated with B-cell chronic lymphocytic leukaemia. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jun 2012]'
• Protein Families: Druggable Genome, Protein Kinase, Transmembrane