SSBP1 (NM_003143) Human Mass Spec Standard
CAT#: PH315106
SSBP1 MS Standard C13 and N15-labeled recombinant protein (NP_003134)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215106 |
Predicted MW | 17.26 kDa |
Protein Sequence |
>RC215106 representing NM_003143
Red=Cloning site Green=Tags(s) MFRRPVLQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDS EVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFL SDQTKEKE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003134 |
RefSeq Size | 628 |
RefSeq ORF | 444 |
Synonyms | Mt-SSB; mtSSB; SOSS-B1; SSBP |
Locus ID | 6742 |
UniProt ID | Q04837, A4D1U3 |
Cytogenetics | 7q34 |
Summary | 'SSBP1 is a housekeeping gene involved in mitochondrial biogenesis (Tiranti et al., 1995 [PubMed 7789991]). It is also a subunit of a single-stranded DNA (ssDNA)-binding complex involved in the maintenance of genome stability (Huang et al., 2009) [PubMed 19683501].[supplied by OMIM, Feb 2010]' |
Protein Families | Druggable Genome |
Protein Pathways | DNA replication, Homologous recombination, Mismatch repair |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401092 | SSBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY401092 | Transient overexpression lysate of single-stranded DNA binding protein 1 (SSBP1) |
USD 325.00 |
|
TP315106 | Recombinant protein of human single-stranded DNA binding protein 1 (SSBP1) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review