SSBP1 (NM_003143) Human Mass Spec Standard

CAT#: PH315106

SSBP1 MS Standard C13 and N15-labeled recombinant protein (NP_003134)

Product Images

Coomassie blue staining of purified SSBP1 protein (Cat# TP315106). The protein was produced from HEK293T cells transfected with SSBP1 cDNA clone (Cat# RC215106) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215106
• Predicted MW: 17.26 kDa
• Protein Sequence:
  Sequence Link

  >RC215106 representing NM_003143
  Red=Cloning site Green=Tags(s)
  
  MFRRPVLQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDS
  EVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFL
  SDQTKEKE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003134
• RefSeq Size: 628
• RefSeq ORF: 444
• Synonyms: Mt-SSB; mtSSB; SOSS-B1; SSBP
• Locus ID: 6742
• UniProt ID: Q04837, A4D1U3
• Cytogenetics: 7q34
• Summary: 'SSBP1 is a housekeeping gene involved in mitochondrial biogenesis (Tiranti et al., 1995 [PubMed 7789991]). It is also a subunit of a single-stranded DNA (ssDNA)-binding complex involved in the maintenance of genome stability (Huang et al., 2009) [PubMed 19683501].[supplied by OMIM, Feb 2010]'
• Protein Families: Druggable Genome
• Protein Pathways: DNA replication, Homologous recombination, Mismatch repair