SSBP1 (NM_003143) Human Recombinant Protein

CAT#: TP315106

Recombinant protein of human single-stranded DNA binding protein 1 (SSBP1)

Product Images

Coomassie blue staining of purified SSBP1 protein (Cat# TP315106). The protein was produced from HEK293T cells transfected with SSBP1 cDNA clone (Cat# RC215106) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC215106 representing NM_003143
  Red=Cloning site Green=Tags(s)
  
  MFRRPVLQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDS
  EVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFL
  SDQTKEKE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 15.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003134
• Locus ID: 6742
• UniProt ID: Q04837, A4D1U3
• Cytogenetics: 7q34
• Refseq Size: 628
• Refseq ORF: 444
• Synonyms: Mt-SSB; mtSSB; SOSS-B1; SSBP
• Summary: SSBP1 is a housekeeping gene involved in mitochondrial biogenesis (Tiranti et al., 1995 [PubMed 7789991]). It is also a subunit of a single-stranded DNA (ssDNA)-binding complex involved in the maintenance of genome stability (Huang et al., 2009) [PubMed 19683501].[supplied by OMIM, Feb 2010]
• Protein Families: Druggable Genome
• Protein Pathways: DNA replication, Homologous recombination, Mismatch repair