Adiponectin (ADIPOQ) (NM_004797) Human Mass Spec Standard

CAT#: PH315161

ADIPOQ MS Standard C13 and N15-labeled recombinant protein (NP_004788)

Product Images

Coomassie blue staining of purified ADIPOQ protein (Cat# TP315161). The protein was produced from HEK293T cells transfected with ADIPOQ cDNA clone (Cat# RC215161) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215161
• Predicted MW: 26.41 kDa
• Protein Sequence:
  Sequence Link

  >RC215161 representing NM_004797
  Red=Cloning site Green=Tags(s)
  
  MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGD
  PGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQ
  NHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQ
  VWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004788
• RefSeq Size: 4592
• RefSeq ORF: 732
• Synonyms: ACDC; ACRP30; ADIPQTL1; ADPN; APM-1; APM1; GBP28
• Locus ID: 9370
• UniProt ID: Q15848, A8K660
• Cytogenetics: 3q27.3
• Summary: This gene is expressed in adipose tissue exclusively. It encodes a protein with similarity to collagens X and VIII and complement factor C1q. The encoded protein circulates in the plasma and is involved with metabolic and hormonal processes. Mutations in this gene are associated with adiponectin deficiency. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Apr 2010]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Adipocytokine signaling pathway, PPAR signaling pathway, Type II diabetes mellitus