Adiponectin (ADIPOQ) (NM_004797) Human Recombinant Protein
CAT#: TP723121
Purified recombinant protein of Human adiponectin, C1Q and collagen domain containing (ADIPOQ), transcript variant 2.
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
|
Tag | Tag Free |
Predicted MW | 16.6 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Determined by its ability to inhibit the proliferation of murine M1 cells. The expected ED50 for this effect is 1.0-3.0ug/mL. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_004788 |
Locus ID | 9370 |
UniProt ID | Q15848, A8K660 |
Cytogenetics | 3q27.3 |
Refseq Size | 4592 |
Refseq ORF | 732 |
Synonyms | ACDC; ACRP30; ADIPQTL1; ADPN; APM-1; APM1; GBP28 |
Summary | This gene is expressed in adipose tissue exclusively. It encodes a protein with similarity to collagens X and VIII and complement factor C1q. The encoded protein circulates in the plasma and is involved with metabolic and hormonal processes. Mutations in this gene are associated with adiponectin deficiency. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Apr 2010] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Adipocytokine signaling pathway, PPAR signaling pathway, Type II diabetes mellitus |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401510 | ADIPOQ HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC432756 | ADIPOQ HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401510 | Transient overexpression lysate of adiponectin, C1Q and collagen domain containing (ADIPOQ) |
USD 396.00 |
|
LY432756 | Transient overexpression lysate of adiponectin, C1Q and collagen domain containing (ADIPOQ), transcript variant 1 |
USD 396.00 |
|
PH315161 | ADIPOQ MS Standard C13 and N15-labeled recombinant protein (NP_004788) |
USD 2,055.00 |
|
TP315161 | Recombinant protein of human adiponectin, C1Q and collagen domain containing (ADIPOQ) |
USD 399.00 |
|
TP700247 | Purified secreted form of human adiponectin, C1Q and collagen domain containing (ADIPOQ), with N-terminal His tag, expressed in human cells, 20ug |
USD 748.00 |
|
TP710245 | Purified recombinant protein of Human adiponectin, C1Q and collagen domain containing (ADIPOQ), transcript variant 2, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
USD 425.00 |
|
TP710246 | Purified recombinant protein of Human adiponectin, C1Q and collagen domain containing (ADIPOQ), transcript variant 2, residues 18-244aa, with C-terminal DDK tag, expressed in sf9, 20ug |
USD 425.00 |
|
TP720685 | Purified recombinant protein of Human adiponectin, C1Q and collagen domain containing (ADIPOQ), transcript variant 2 |
USD 330.00 |
|
TP723006 | Purified recombinant protein of Human adiponectin, C1Q and collagen domain containing (ADIPOQ), transcript variant 2. |
USD 240.00 |
|
TP723122 | Purified recombinant protein of Human adiponectin, C1Q and collagen domain containing (ADIPOQ), transcript variant 2. |
USD 240.00 |
|
TP790074 | Purified recombinant protein of Human adiponectin, C1Q and collagen domain containing (ADIPOQ), transcript variant 2, esidues 19-244aa, with C-terminal DDK tag, secretory expressed in CHO cells, 50ug |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review