PAICS (NM_006452) Human Mass Spec Standard
CAT#: PH315225
PAICS MS Standard C13 and N15-labeled recombinant protein (NP_006443)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC215225 |
| Predicted MW | 47.1 kDa |
| Protein Sequence |
>RC215225 protein sequence
Red=Cloning site Green=Tags(s) MATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQE AGIKTAFTRKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQW SEEQLIAAKFCFAGLLIGQTEVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVID NDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGH CEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISC PPLTPDWGVQDVWSSLRLPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWSKLRASILNTWISLKQADKKI RECNL myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_006443 |
| RefSeq Size | 3350 |
| RefSeq ORF | 1275 |
| Synonyms | ADE2; ADE2H1; AIRC; PAIS |
| Locus ID | 10606 |
| UniProt ID | P22234 |
| Cytogenetics | 4q12 |
| Summary | This gene encodes a bifunctional enzyme containing phosphoribosylaminoimidazole carboxylase activity in its N-terminal region and phosphoribosylaminoimidazole succinocarboxamide synthetase in its C-terminal region. It catalyzes steps 6 and 7 of purine biosynthesis. The gene is closely linked and divergently transcribed with a locus that encodes an enzyme in the same pathway, and transcription of the two genes is coordinately regulated. The human genome contains several pseudogenes of this gene. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolic pathways, Purine metabolism |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416636 | PAICS HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC421514 | PAICS HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC421515 | PAICS HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
| LC425883 | PAICS HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC425884 | PAICS HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
| LY416636 | Transient overexpression lysate of phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 2 |
USD 436.00 |
|
| LY421514 | Transient overexpression lysate of phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 3 |
USD 436.00 |
|
| LY421515 | Transient overexpression lysate of phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 1 |
USD 665.00 |
|
| LY425883 | Transient overexpression lysate of phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 3 |
USD 396.00 |
|
| LY425884 | Transient overexpression lysate of phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 1 |
USD 396.00 |
|
| PH301530 | PAICS MS Standard C13 and N15-labeled recombinant protein (NP_001072992) |
USD 2,055.00 |
|
| TP301530 | Recombinant protein of human phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 3 |
USD 867.00 |
|
| TP315225 | Recombinant protein of human phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China