ARL5A (NM_012097) Human Mass Spec Standard

CAT#: PH315504

ARL5A MS Standard C13 and N15-labeled recombinant protein (NP_036229)

Product Images

Coomassie blue staining of purified ARL5A protein (Cat# TP315504). The protein was produced from HEK293T cells transfected with ARL5A cDNA clone (Cat# RC215504) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215504
• Predicted MW: 20.7 kDa
• Protein Sequence:
  Sequence Link

  >RC215504 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQ
  ESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQ
  FLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRLKIR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036229
• RefSeq Size: 3169
• RefSeq ORF: 537
• Synonyms: ARFLP5; ARL5
• Locus ID: 26225
• UniProt ID: Q9Y689
• Cytogenetics: 2q23.3
• Summary: The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes. [provided by RefSeq, Jul 2008]