ARL5A (NM_001037174) Human Recombinant Protein

CAT#: TP301516

Purified recombinant protein of Homo sapiens ADP-ribosylation factor-like 5A (ARL5A), transcript variant 3

Product Images

Coomassie blue staining of purified ARL5A protein (Cat# TP301516). The protein was produced from HEK293T cells transfected with ARL5A cDNA clone (Cat# RC201516) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201516 representing NM_001037174
  Red=Cloning site Green=Tags(s)
  
  MGILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQ
  ESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQ
  FLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRLKIR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 16.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001032251
• Locus ID: 26225
• UniProt ID: Q9Y689
• Cytogenetics: 2q23.3
• Refseq Size: 2913
• Refseq ORF: 537
• Synonyms: ARFLP5; ARL5
• Summary: The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes. [provided by RefSeq, Jul 2008]