ARL5A (NM_001037174) Human Recombinant Protein
CAT#: TP301516
Purified recombinant protein of Homo sapiens ADP-ribosylation factor-like 5A (ARL5A), transcript variant 3
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201516 representing NM_001037174
Red=Cloning site Green=Tags(s) MGILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQ ESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQ FLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRLKIR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.2 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001032251 |
Locus ID | 26225 |
UniProt ID | Q9Y689 |
Cytogenetics | 2q23.3 |
Refseq Size | 2913 |
Refseq ORF | 537 |
Synonyms | ARFLP5; ARL5 |
Summary | The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415981 | ARL5A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC421930 | ARL5A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425612 | ARL5A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY415981 | Transient overexpression lysate of ADP-ribosylation factor-like 5A (ARL5A), transcript variant 1 |
USD 396.00 |
|
LY421930 | Transient overexpression lysate of ADP-ribosylation factor-like 5A (ARL5A), transcript variant 3 |
USD 396.00 |
|
LY425612 | Transient overexpression lysate of ADP-ribosylation factor-like 5A (ARL5A), transcript variant 3 |
USD 396.00 |
|
PH301516 | ARL5A MS Standard C13 and N15-labeled recombinant protein (NP_001032251) |
USD 2,055.00 |
|
PH315504 | ARL5A MS Standard C13 and N15-labeled recombinant protein (NP_036229) |
USD 2,055.00 |
|
TP315504 | Recombinant protein of human ADP-ribosylation factor-like 5A (ARL5A), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review