FGFR3 (NM_000142) Human Mass Spec Standard
CAT#: PH315533
FGFR3 MS Standard C13 and N15-labeled recombinant protein (NP_000133)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC215533 |
| Predicted MW | 87.71 kDa |
| Protein Sequence |
>RC215533 representing NM_000142
Red=Cloning site Green=Tags(s) MGAPACALALCVAVAIVAGASSESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMG PTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDE AEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQ WSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSD AQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHH SAWLVVLPAEEELVEADEAGSVYAGILSYGVGFFLFILVVAAVTLCRLRSPPKKGLGSPTVHKISRFPLK RQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAE AIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAK GNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNV MKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPV EELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQY SPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT TRRLEQKLISEEDLAANDILDYKDDDDKV |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_000133 |
| RefSeq Size | 4093 |
| RefSeq ORF | 2418 |
| Synonyms | ACH; CD333; CEK2; HSFGFR3EX; JTK4 |
| Locus ID | 2261 |
| UniProt ID | P22607, Q0IJ44 |
| Cytogenetics | 4p16.3 |
| Summary | 'This gene encodes a member of the fibroblast growth factor receptor (FGFR) family, with its amino acid sequence being highly conserved between members and among divergent species. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein would consist of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member binds acidic and basic fibroblast growth hormone and plays a role in bone development and maintenance. Mutations in this gene lead to craniosynostosis and multiple types of skeletal dysplasia. [provided by RefSeq, Aug 2017]' |
| Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
| Protein Pathways | Bladder cancer, Endocytosis, MAPK signaling pathway, Pathways in cancer, Regulation of actin cytoskeleton |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424902 | FGFR3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LY424902 | Transient overexpression lysate of fibroblast growth factor receptor 3 (FGFR3), transcript variant 1 |
USD 665.00 |
|
| TP315533 | Recombinant protein of human fibroblast growth factor receptor 3 (FGFR3), transcript variant 1 |
USD 788.00 |
|
| TP700122 | Purified recombinant protein of human fibroblast growth factor receptor 3 (achondroplasia, thanatophoric dwarfism)(FGFR3), transcript variant 1, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
USD 748.00 |
|
| TP700123 | Purified recombinant protein of human fibroblast growth factor receptor 3 (achondroplasia, thanatophoric dwarfism)(FGFR3), transcript variant 2, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
USD 748.00 |
|
| TP700124 | Purified recombinant protein of human fibroblast growth factor receptor 3 (achondroplasia, thanatophoric dwarfism)(FGFR3), transcript variant 3, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
USD 748.00 |
|
| TP710033 | Recombinant protein of human fibroblast growth factor receptor 3 (FGFR3), residues 23-375, with C-terminal DDK tag, expressed in sf9 cells. |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China