TMS1 (PYCARD) (NM_013258) Human Mass Spec Standard

CAT#: PH315592

PYCARD MS Standard C13 and N15-labeled recombinant protein (NP_037390)

Product Images

Coomassie blue staining of purified PYCARD protein (Cat# TP315592). The protein was produced from HEK293T cells transfected with PYCARD cDNA clone (Cat# RC215592) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215592
• Predicted MW: 21.4 kDa
• Protein Sequence:
  Sequence Link

  >RC215592 representing NM_013258
  Red=Cloning site Green=Tags(s)
  
  MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFYLETYGAELTA
  NVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKV
  LTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_037390
• RefSeq Size: 936
• RefSeq ORF: 585
• Synonyms: ASC; CARD5; TMS; TMS-1; TMS1
• Locus ID: 29108
• UniProt ID: Q9ULZ3
• Cytogenetics: 16p11.2
• Summary: This gene encodes an adaptor protein that is composed of two protein-protein interaction domains: a N-terminal PYRIN-PAAD-DAPIN domain (PYD) and a C-terminal caspase-recruitment domain (CARD). The PYD and CARD domains are members of the six-helix bundle death domain-fold superfamily that mediates assembly of large signaling complexes in the inflammatory and apoptotic signaling pathways via the activation of caspase. In normal cells, this protein is localized to the cytoplasm; however, in cells undergoing apoptosis, it forms ball-like aggregates near the nuclear periphery. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Cytosolic DNA-sensing pathway, NOD-like receptor signaling pathway