TMS1 (PYCARD) (NM_145183) Human Recombinant Protein
CAT#: TP302409
Recombinant protein of human PYD and CARD domain containing (PYCARD), transcript variant 3
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202409 protein sequence
Red=Cloning site Green=Tags(s) MGRARDAILDALENLTAEELKKFKLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVE WLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 15.5 |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_660184 |
Locus ID | 29108 |
UniProt ID | Q9ULZ3 |
Cytogenetics | 16p11.2 |
Refseq Size | 763 |
Refseq ORF | 405 |
Synonyms | apoptosis-associated speck-like protein containing a CARD; ASC; ASC, TMS1, CARD5, MGC10332; CARD5; caspase recruitment domain protein 5; MGC10332; PYD and CARD domain containing; target of methylation-induced silencing-1; TMS; TMS-1; TMS1 |
Summary | This gene encodes an adaptor protein that is composed of two protein-protein interaction domains: a N-terminal PYRIN-PAAD-DAPIN domain (PYD) and a C-terminal caspase-recruitment domain (CARD). The PYD and CARD domains are members of the six-helix bundle death domain-fold superfamily that mediates assembly of large signaling complexes in the inflammatory and apoptotic signaling pathways via the activation of caspase. In normal cells, this protein is localized to the cytoplasm; however, in cells undergoing apoptosis, it forms ball-like aggregates near the nuclear periphery. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Cytosolic DNA-sensing pathway, NOD-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402233 | PYCARD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC408042 | PYCARD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY402233 | Transient overexpression lysate of PYD and CARD domain containing (PYCARD), transcript variant 1 |
USD 325.00 |
|
LY408042 | Transient overexpression lysate of PYD and CARD domain containing (PYCARD), transcript variant 3 |
USD 325.00 |
|
PH302409 | PYCARD MS Standard C13 and N15-labeled recombinant protein (NP_660184) |
USD 2,055.00 |
|
PH315592 | PYCARD MS Standard C13 and N15-labeled recombinant protein (NP_037390) |
USD 2,055.00 |
|
PH324051 | PYCARD MS Standard C13 and N15-labeled recombinant protein (NP_660183) |
USD 2,055.00 |
|
TP315592 | Recombinant protein of human PYD and CARD domain containing (PYCARD), transcript variant 1 |
USD 867.00 |
|
TP324051 | Recombinant protein of human PYD and CARD domain containing (PYCARD), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review