HGF (NM_000601) Human Mass Spec Standard
CAT#: PH315593
HGF MS Standard C13 and N15-labeled recombinant protein (NP_000592)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215593 |
Predicted MW | 83.13 kDa |
Protein Sequence |
>RC215593 representing NM_000601
Red=Cloning site Green=Tags(s) MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQC ANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTV SITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVE CMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRW EYCAIKTCADNTMNDTDVPLETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLR ENYCRNPDGSESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNME DLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKT KQLRVVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEK CKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLR VAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIP NRPGIFVRVAYYAKWIHKIILTYKVPQS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000592 |
RefSeq Size | 2820 |
RefSeq ORF | 2184 |
Synonyms | DFNB39; F-TCF; HGFB; HPTA; SF |
Locus ID | 3082 |
UniProt ID | P14210 |
Cytogenetics | 7q21.11 |
Summary | 'This gene encodes a protein that binds to the hepatocyte growth factor receptor to regulate cell growth, cell motility and morphogenesis in numerous cell and tissue types. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate alpha and beta chains, which form the mature heterodimer. This protein is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. This protein also plays a role in angiogenesis, tumorogenesis, and tissue regeneration. Although the encoded protein is a member of the peptidase S1 family of serine proteases, it lacks peptidase activity. Mutations in this gene are associated with nonsyndromic hearing loss. [provided by RefSeq, Nov 2015]' |
Protein Families | Adult stem cells, Druggable Genome, ES Cell Differentiation/IPS, Protease, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction, Focal adhesion, Melanoma, Pathways in cancer, Renal cell carcinoma |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400200 | HGF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC423236 | HGF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC423238 | HGF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425287 | HGF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425289 | HGF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400200 | Transient overexpression lysate of hepatocyte growth factor (hepapoietin A; scatter factor) (HGF), transcript variant 1 |
USD 495.00 |
|
LY423236 | Transient overexpression lysate of hepatocyte growth factor (hepapoietin A; scatter factor) (HGF), transcript variant 2 |
USD 325.00 |
|
LY423238 | Transient overexpression lysate of hepatocyte growth factor (hepapoietin A; scatter factor) (HGF), transcript variant 4 |
USD 325.00 |
|
LY425287 | Transient overexpression lysate of hepatocyte growth factor (hepapoietin A; scatter factor) (HGF), transcript variant 2 |
USD 325.00 |
|
LY425289 | Transient overexpression lysate of hepatocyte growth factor (hepapoietin A; scatter factor) (HGF), transcript variant 4 |
USD 325.00 |
|
TP315593 | Recombinant protein of human hepatocyte growth factor (hepapoietin A; scatter factor) (HGF), transcript variant 1 |
USD 788.00 |
|
TP723156 | Purified recombinant protein of Human hepatocyte growth factor (hepapoietin A; scatter factor) (HGF), transcript variant 1. |
USD 240.00 |
{0} Product Review(s)
Be the first one to submit a review