HGF (NM_000601) Human Recombinant Protein
CAT#: TP723156
Purified recombinant protein of Human hepatocyte growth factor (hepapoietin A; scatter factor) (HGF), transcript variant 1.
Specifications
| Product Data | |
| Species | Human |
| Expression Host | Hi-5 insect |
| Expression cDNA Clone or AA Sequence |
alphachain:QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPLETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLRENYCRNPDGSESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNMEDLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLR betachain:VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS |
| Tag | Tag Free |
| Predicted MW | 83.13 |
| Concentration | Resuspend the protein in the desired concentration in proper buffer |
| Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
| Bioactivity | ED50 was determined by the dose-dependent stimulation of the proliferation of monkey 4MBr-5 cells was found to be in the range of 20.0-40.0 ng/ml. |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
| Storage | Store at -80°C. |
| Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_000592 |
| Locus ID | 3082 |
| UniProt ID | P14210 |
| Cytogenetics | 7q21.11 |
| Refseq Size | 2820 |
| Refseq ORF | 2184 |
| Synonyms | DFNB39; F-TCF; HGFB; HPTA; SF |
| Summary | 'This gene encodes a protein that binds to the hepatocyte growth factor receptor to regulate cell growth, cell motility and morphogenesis in numerous cell and tissue types. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate alpha and beta chains, which form the mature heterodimer. This protein is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. This protein also plays a role in angiogenesis, tumorogenesis, and tissue regeneration. Although the encoded protein is a member of the peptidase S1 family of serine proteases, it lacks peptidase activity. Mutations in this gene are associated with nonsyndromic hearing loss. [provided by RefSeq, Nov 2015]' |
| Protein Families | Adult stem cells, Druggable Genome, ES Cell Differentiation/IPS, Protease, Transmembrane |
| Protein Pathways | Cytokine-cytokine receptor interaction, Focal adhesion, Melanoma, Pathways in cancer, Renal cell carcinoma |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400200 | HGF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC423236 | HGF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC423238 | HGF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC425287 | HGF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC425289 | HGF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400200 | Transient overexpression lysate of hepatocyte growth factor (hepapoietin A; scatter factor) (HGF), transcript variant 1 |
USD 665.00 |
|
| LY423236 | Transient overexpression lysate of hepatocyte growth factor (hepapoietin A; scatter factor) (HGF), transcript variant 2 |
USD 436.00 |
|
| LY423238 | Transient overexpression lysate of hepatocyte growth factor (hepapoietin A; scatter factor) (HGF), transcript variant 4 |
USD 436.00 |
|
| LY425287 | Transient overexpression lysate of hepatocyte growth factor (hepapoietin A; scatter factor) (HGF), transcript variant 2 |
USD 396.00 |
|
| LY425289 | Transient overexpression lysate of hepatocyte growth factor (hepapoietin A; scatter factor) (HGF), transcript variant 4 |
USD 396.00 |
|
| PH315593 | HGF MS Standard C13 and N15-labeled recombinant protein (NP_000592) |
USD 2,055.00 |
|
| TP315593 | Recombinant protein of human hepatocyte growth factor (hepapoietin A; scatter factor) (HGF), transcript variant 1 |
USD 788.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China