SIVA (SIVA1) (NM_006427) Human Mass Spec Standard
CAT#: PH315680
SIVA1 MS Standard C13 and N15-labeled recombinant protein (NP_006418)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC215680 |
| Predicted MW | 18.5 kDa |
| Protein Sequence |
>RC215680 representing NM_006427
Red=Cloning site Green=Tags(s) MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFEKTKRLLFLGAQAYLDHVWDEGCAVVHLPES PKPGPTGAPRAARGQMLIGPDGRLIRSLGQASEADPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVR TCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_006418 |
| RefSeq Size | 751 |
| RefSeq ORF | 525 |
| Synonyms | CD27BP; SIVA; Siva-1; Siva-2 |
| Locus ID | 10572 |
| UniProt ID | O15304 |
| Cytogenetics | 14q32.33 |
| Summary | This gene encodes an E3 ubiquitin ligase that regulates cell cycle progression, cell proliferation and apoptosis. The N-terminus of this protein binds to the cytoplasmic tail of the CD27 antigen, a member of the tumor necrosis factor receptor (TNFR) superfamily. In response to UV radiation-induced DNA damage, this protein has been shown to mediate the ubiquitination of proliferating cell nuclear antigen (PCNA), an important step in translesion DNA synthesis. [provided by RefSeq, Sep 2018] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411940 | SIVA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC416652 | SIVA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY411940 | Transient overexpression lysate of SIVA1, apoptosis-inducing factor (SIVA1), transcript variant 2 |
USD 436.00 |
|
| LY416652 | Transient overexpression lysate of SIVA1, apoptosis-inducing factor (SIVA1), transcript variant 1 |
USD 436.00 |
|
| TP315680 | Recombinant protein of human SIVA1, apoptosis-inducing factor (SIVA1), transcript variant 1 |
USD 748.00 |
|
| TP761811 | Purified recombinant protein of Human SIVA1, apoptosis-inducing factor (SIVA1), transcript variant 2, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China