SIVA (SIVA1) (NM_006427) Human Mass Spec Standard

CAT#: PH315680

SIVA1 MS Standard C13 and N15-labeled recombinant protein (NP_006418)

Product Images

Coomassie blue staining of purified SIVA1 protein (Cat# TP315680). The protein was produced from HEK293T cells transfected with SIVA1 cDNA clone (Cat# RC215680) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215680
• Predicted MW: 18.5 kDa
• Protein Sequence:
  Sequence Link

  >RC215680 representing NM_006427
  Red=Cloning site Green=Tags(s)
  
  MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFEKTKRLLFLGAQAYLDHVWDEGCAVVHLPES
  PKPGPTGAPRAARGQMLIGPDGRLIRSLGQASEADPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVR
  TCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006418
• RefSeq Size: 751
• RefSeq ORF: 525
• Synonyms: CD27BP; SIVA; Siva-1; Siva-2
• Locus ID: 10572
• UniProt ID: O15304
• Cytogenetics: 14q32.33
• Summary: This gene encodes an E3 ubiquitin ligase that regulates cell cycle progression, cell proliferation and apoptosis. The N-terminus of this protein binds to the cytoplasmic tail of the CD27 antigen, a member of the tumor necrosis factor receptor (TNFR) superfamily. In response to UV radiation-induced DNA damage, this protein has been shown to mediate the ubiquitination of proliferating cell nuclear antigen (PCNA), an important step in translesion DNA synthesis. [provided by RefSeq, Sep 2018]
• Protein Families: Druggable Genome