FABP9 (NM_001080526) Human Mass Spec Standard
CAT#: PH315816
FABP9 MS Standard C13 and N15-labeled recombinant protein (NP_001073995)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215816 |
Predicted MW | 14.9 kDa |
Protein Sequence |
>RC215816 representing NM_001080526
Red=Cloning site Green=Tags(s) MVEPFLGTWKLVSSENFEDYMKELGVNFAARNMAGLVKPTVTISVDGKMMTIRTESSFQDTKISFKLGEE FDETTADNRKVKSTITLENGSMIHVQKWLGKETTIKRKIVDEKMVVECKMNNIVSTRIYEKV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001073995 |
RefSeq Size | 399 |
RefSeq ORF | 396 |
Synonyms | PERF; PERF15; T-FABP; TLBP |
Locus ID | 646480 |
UniProt ID | Q0Z7S8 |
Cytogenetics | 8q21.13 |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421081 | FABP9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY421081 | Transient overexpression lysate of fatty acid binding protein 9, testis (FABP9) |
USD 396.00 |
|
TP315816 | Recombinant protein of human fatty acid binding protein 9, testis (FABP9) |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review