FABP9 (NM_001080526) Human Mass Spec Standard

CAT#: PH315816

FABP9 MS Standard C13 and N15-labeled recombinant protein (NP_001073995)

Product Images

Coomassie blue staining of purified FABP9 protein (Cat# TP315816). The protein was produced from HEK293T cells transfected with FABP9 cDNA clone (Cat# RC215816) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215816
• Predicted MW: 14.9 kDa
• Protein Sequence:
  Sequence Link

  >RC215816 representing NM_001080526
  Red=Cloning site Green=Tags(s)
  
  MVEPFLGTWKLVSSENFEDYMKELGVNFAARNMAGLVKPTVTISVDGKMMTIRTESSFQDTKISFKLGEE
  FDETTADNRKVKSTITLENGSMIHVQKWLGKETTIKRKIVDEKMVVECKMNNIVSTRIYEKV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001073995
• RefSeq Size: 399
• RefSeq ORF: 396
• Synonyms: PERF; PERF15; T-FABP; TLBP
• Locus ID: 646480
• UniProt ID: Q0Z7S8
• Cytogenetics: 8q21.13