14-3-3 beta (YWHAB) (NM_003404) Human Mass Spec Standard

CAT#: PH315940

YWHAB MS Standard C13 and N15-labeled recombinant protein (NP_003395)

Product Images

Coomassie blue staining of purified YWHAB protein (Cat# TP315940). The protein was produced from HEK293T cells transfected with YWHAB cDNA clone (Cat# RC215940) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215940
• Predicted MW: 28.1 kDa
• Protein Sequence:
  Sequence Link

  >RC215940 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQK
  TERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNK
  QTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNE
  ESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003395
• RefSeq Size: 3231
• RefSeq ORF: 738
• Synonyms: GW128; HEL-S-1; HS1; KCIP-1; YWHAA
• Locus ID: 7529
• UniProt ID: P31946, V9HWD6
• Cytogenetics: 20q13.12
• Summary: 'This gene encodes a protein belonging to the 14-3-3 family of proteins, members of which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals. The encoded protein has been shown to interact with RAF1 and CDC25 phosphatases, suggesting that it may play a role in linking mitogenic signaling and the cell cycle machinery. Two transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome
• Protein Pathways: Cell cycle, Neurotrophin signaling pathway, Oocyte meiosis