14-3-3 beta (YWHAB) (NM_003404) Human Mass Spec Standard
CAT#: PH315940
YWHAB MS Standard C13 and N15-labeled recombinant protein (NP_003395)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215940 |
Predicted MW | 28.1 kDa |
Protein Sequence |
>RC215940 protein sequence
Red=Cloning site Green=Tags(s) MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQK TERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNK QTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNE ESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003395 |
RefSeq Size | 3231 |
RefSeq ORF | 738 |
Synonyms | GW128; HEL-S-1; HS1; KCIP-1; YWHAA |
Locus ID | 7529 |
UniProt ID | P31946, V9HWD6 |
Cytogenetics | 20q13.12 |
Summary | 'This gene encodes a protein belonging to the 14-3-3 family of proteins, members of which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals. The encoded protein has been shown to interact with RAF1 and CDC25 phosphatases, suggesting that it may play a role in linking mitogenic signaling and the cell cycle machinery. Two transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle, Neurotrophin signaling pathway, Oocyte meiosis |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403387 | YWHAB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC418677 | YWHAB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY403387 | Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide (YWHAB), transcript variant 2 |
USD 325.00 |
|
LY418677 | Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide (YWHAB), transcript variant 1 |
USD 325.00 |
|
PH300402 | YWHAB MS Standard C13 and N15-labeled recombinant protein (NP_647539) |
USD 2,055.00 |
|
TP300402 | Recombinant protein of human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide (YWHAB), transcript variant 2 |
USD 823.00 |
|
TP315940 | Recombinant protein of human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide (YWHAB), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review