14-3-3 beta (YWHAB) (NM_003404) Human Recombinant Protein

CAT#: TP315940

Recombinant protein of human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide (YWHAB), transcript variant 1

Product Images

Coomassie blue staining of purified YWHAB protein (Cat# TP315940). The protein was produced from HEK293T cells transfected with YWHAB cDNA clone (Cat# RC215940) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC215940 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQK
  TERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNK
  QTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNE
  ESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 27.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003395
• Locus ID: 7529
• UniProt ID: P31946, V9HWD6
• Cytogenetics: 20q13.12
• Refseq Size: 3231
• Refseq ORF: 738
• Synonyms: GW128; HEL-S-1; HS1; KCIP-1; YWHAA
• Summary: This gene encodes a protein belonging to the 14-3-3 family of proteins, members of which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals. The encoded protein has been shown to interact with RAF1 and CDC25 phosphatases, suggesting that it may play a role in linking mitogenic signaling and the cell cycle machinery. Two transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Cell cycle, Neurotrophin signaling pathway, Oocyte meiosis