Estrogen Related Receptor beta (ESRRB) (NM_004452) Human Mass Spec Standard

CAT#: PH315995

ESRRB MS Standard C13 and N15-labeled recombinant protein (NP_004443)

Product Images

Coomassie blue staining of purified ESRRB protein (Cat# TP315995). The protein was produced from HEK293T cells transfected with ESRRB cDNA clone (Cat# RC215995) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215995
• Predicted MW: 56 kDa
• Protein Sequence:
  Sequence Link

  >RC215995 representing NM_004452
  Red=Cloning site Green=Tags(s)
  
  MSSDDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGLALGTHANGLDSPPMFAGAGLGGT
  PCRKSYEDCASGIMEDSAIKCEYMLNAIPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCP
  ATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRLDSESSPYLSLQISPPAKKPLT
  KIVSYLLVAEPDKLYAMPPPGMPEGDIKALTTLCDLADRELVVIIGWAKHIPGFSSLSLGDQMSLLQSAW
  MEILILGIVYRSLPYDDKLVYAEDYIMDEEHSRLAGLLELYRAILQLVRRYKKLKVEKEEFVTLKALALA
  NSDSMYIEDLEAVQKLQDLLHEALQDYELSQRHEEPWRTGKLLLTLPLLRQTAAKAVQHFYSVKLQGKVP
  MHKLFLEMLEAKAWARADSLQEWRPLEQVPSPLHRATKRQHVHFLTPLPPPPSVAWVGTAQAGYHLEVFL
  PQRAGWPRAA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004443
• RefSeq Size: 2193
• RefSeq ORF: 1500
• Synonyms: DFNB35; ERR2; ERRb; ESRL2; NR3B2
• Locus ID: 2103
• UniProt ID: O95718
• Cytogenetics: 14q24.3
• Summary: 'This gene encodes a protein with similarity to the estrogen receptor. Its function is unknown; however, a similar protein in mouse plays an essential role in placental development. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transcription Factors