LRRC2 (NM_024512) Human Mass Spec Standard

CAT#: PH316196

LRRC2 MS Standard C13 and N15-labeled recombinant protein (NP_078788)

Product Images

Coomassie blue staining of purified LRRC2 protein (Cat# TP316196). The protein was produced from HEK293T cells transfected with LRRC2 cDNA clone (Cat# RC216196) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC216196
• Predicted MW: 42.8 kDa
• Protein Sequence:
  Sequence Link

  >RC216196 representing NM_024512
  Red=Cloning site Green=Tags(s)
  
  MGHKVVVFDISVIRALWETRVKKHKAWQKKEVERLEKSALEKIKEEWNFVAECRRKGIPQAVYCKNGFID
  TSVRLLDKIERNTLTRQSSLPKDRGKRSSAFVFELSGEHWTELPDSLKEQTHLREWYISNTLIQIIPTYI
  QLFQAMRILDLPKNQISHLPAEIGCLKNLKELNVGFNYLKSIPPELGDCENLERLDCSGNLELMELPFEL
  SNLKQVTFVDISANKFSSVPICVLRMSNLQWLDISSNNLTDLPQDIDRLEELQSFLLYKNKLTYLPYSML
  NLKKLTLLVVSGDHLVELPTALCDSSTPLKFVSLMDNPIDNAQCEDGNEIMESERDRQHFDKEVMKAYIE
  DLKERESVPSYTTKVSFSLQL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_078788
• RefSeq Size: 4860
• RefSeq ORF: 1113
• Synonyms: leucine-rich repeat-containing 2; leucine rich repeat containing 2
• Locus ID: 79442
• UniProt ID: Q9BYS8
• Cytogenetics: 3p21.31
• Summary: This gene encodes a member of the leucine-rich repeat-containing family of proteins, which function in diverse biological pathways. This family member may possibly be a nuclear protein. Similarity to the RAS suppressor protein, as well as expression down-regulation observed in tumor cells, suggests that it may function as a tumor suppressor. The gene is located in the chromosome 3 common eliminated region 1 (C3CER1), a 1.4 Mb region that is commonly deleted in diverse tumors. A related pseudogene has been identified on chromosome 2. [provided by RefSeq, Sep 2011]
• Protein Families: Druggable Genome