LRRC2 (NM_024750) Human Recombinant Protein

CAT#: TP306380

Recombinant protein of human leucine rich repeat containing 2 (LRRC2), transcript variant 2

Product Images

Coomassie blue staining of purified LRRC2 protein (Cat# TP306380). The protein was produced from HEK293T cells transfected with LRRC2 cDNA clone (Cat# RC206380) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206380 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGHKVVVFDISVIRALWETRVKKHKAWQKKEVERLEKSALEKIKEEWNFVAECRRKGIPQAVYCKNGFID
  TSVRLLDKIERNTLTRQSSLPKDRGKRSSAFVFELSGEHWTELPDSLKEQTHLREWYISNTLIQIIPTYI
  QLFQAMRILDLPKNQISHLPAEIGCLKNLKELNVGFNYLKSIPPELGDCENLERLDCSGNLELMELPFEL
  SNLKQVTFVDISANKFSSVPICVLRMSNLQWLDISSNNLTDLPQDIDRLEELQSFLLYKNKLTYLPYSML
  NLKKLTLLVVSGDHLVELPTALCDSSTPLKFVSLMDNPIDNAQCEDGNEIMESERDRQHFDKEVMKAYIE
  DLKERESVPSYTTKVSFSLQL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 42.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_079026
• Locus ID: 79442
• UniProt ID: Q9BYS8
• Cytogenetics: 3p21.31
• Refseq Size: 4909
• Refseq ORF: 1113
• Synonyms: leucine-rich repeat-containing 2; leucine rich repeat containing 2
• Summary: This gene encodes a member of the leucine-rich repeat-containing family of proteins, which function in diverse biological pathways. This family member may possibly be a nuclear protein. Similarity to the RAS suppressor protein, as well as expression down-regulation observed in tumor cells, suggests that it may function as a tumor suppressor. The gene is located in the chromosome 3 common eliminated region 1 (C3CER1), a 1.4 Mb region that is commonly deleted in diverse tumors. A related pseudogene has been identified on chromosome 2. [provided by RefSeq, Sep 2011]
• Protein Families: Druggable Genome