IL24 (NM_006850) Human Mass Spec Standard
CAT#: PH316502
IL24 MS Standard C13 and N15-labeled recombinant protein (NP_006841)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC216502 |
| Predicted MW | 23.9 kDa |
| Protein Sequence |
>RC216502 protein sequence
Red=Cloning site Green=Tags(s) MNFQQRLQSLWTLASRPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKL WEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFST LANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_006841 |
| RefSeq Size | 1976 |
| RefSeq ORF | 621 |
| Synonyms | C49A; FISP; IL10B; MDA7; MOB5; ST16 |
| Locus ID | 11009 |
| UniProt ID | Q13007 |
| Cytogenetics | 1q32.1 |
| Summary | This gene encodes a member of the IL10 family of cytokines. It was identified as a gene induced during terminal differentiation in melanoma cells. The protein encoded by this gene can induce apoptosis selectively in various cancer cells. Overexpression of this gene leads to elevated expression of several GADD family genes, which correlates with the induction of apoptosis. The phosphorylation of mitogen-activated protein kinase 14 (MAPK7/P38), and heat shock 27kDa protein 1 (HSPB2/HSP27) are found to be induced by this gene in melanoma cells, but not in normal immortal melanocytes. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416383 | IL24 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY416383 | Transient overexpression lysate of interleukin 24 (IL24), transcript variant 1 |
USD 436.00 |
|
| TP316502 | Recombinant protein of human interleukin 24 (IL24), transcript variant 1 |
USD 399.00 |
|
| TP723222 | Purified recombinant protein of Human interleukin 24 (IL24), transcript variant 1. |
USD 240.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China