IL24 (NM_006850) Human Recombinant Protein
CAT#: TP723222
Purified recombinant protein of Human interleukin 24 (IL24), transcript variant 1.
Product Images
![](https://cdn.origene.com/img/defaults-img.jpg)
Specifications
Product Data | |
Species | Human |
Expression Host | CHO |
Expression cDNA Clone or AA Sequence |
QEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKLHHHHHH
|
Tag | C-His |
Predicted MW | 18.9 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_006841 |
Locus ID | 11009 |
UniProt ID | Q13007 |
Cytogenetics | 1q32.1 |
Refseq Size | 1976 |
Refseq ORF | 621 |
Synonyms | C49A; FISP; IL10B; MDA7; MOB5; ST16 |
Summary | This gene encodes a member of the IL10 family of cytokines. It was identified as a gene induced during terminal differentiation in melanoma cells. The protein encoded by this gene can induce apoptosis selectively in various cancer cells. Overexpression of this gene leads to elevated expression of several GADD family genes, which correlates with the induction of apoptosis. The phosphorylation of mitogen-activated protein kinase 14 (MAPK7/P38), and heat shock 27kDa protein 1 (HSPB2/HSP27) are found to be induced by this gene in melanoma cells, but not in normal immortal melanocytes. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416383 | IL24 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY416383 | Transient overexpression lysate of interleukin 24 (IL24), transcript variant 1 |
USD 396.00 |
|
PH316502 | IL24 MS Standard C13 and N15-labeled recombinant protein (NP_006841) |
USD 2,055.00 |
|
TP316502 | Recombinant protein of human interleukin 24 (IL24), transcript variant 1 |
USD 399.00 |
{0} Product Review(s)
Be the first one to submit a review