CD98 (SLC3A2) (NM_002394) Human Mass Spec Standard
CAT#: PH316640
SLC3A2 MS Standard C13 and N15-labeled recombinant protein (NP_002385)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC216640 |
| Predicted MW | 68 kDa |
| Protein Sequence |
>RC216640 protein sequence
Red=Cloning site Green=Tags(s) MELQPPEASIAVVSIPRQLPGSHSEAGVQGLSAGDDSELGSHCVAQTGLELLASGDPLPSASQNAEMIET GSDCVTQAGLQLLASSDPPALASKNAEVTGTMSQDTEVDMKEVELNELEPEKQPMNAASGAAMSLAGAEK NGLVKIKVAEDEAEAAAAAKFTGLSKEELLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVRAPRC RELPAQKWWHTGALYRIGDLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQI DPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDI ENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYLSDSGSTGEHTKSLVT QYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQLMLFTLPGTPVFSYGDEIGLDAAALPGQPMEAPVML WDESSFPDIPGAVSANMTVKGQSEDPGSLLSLFRRLSDQRSKERSLLHGDFHAFSAGPGLFSYIRHWDQN ERFLVVLNFGDVGLSAGLQASDLPASASLPAKADLLLSTQPGREEGSPLELERLKLEPHEGLLLRFPYAA SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_002385 |
| RefSeq Size | 2347 |
| RefSeq ORF | 1890 |
| Synonyms | 4F2; 4F2HC; 4T2HC; CD98; CD98HC; MDU1; NACAE |
| Locus ID | 6520 |
| UniProt ID | P08195 |
| Cytogenetics | 11q12.3 |
| Summary | This gene is a member of the solute carrier family and encodes a cell surface, transmembrane protein. The protein exists as the heavy chain of a heterodimer, covalently bound through di-sulfide bonds to one of several possible light chains. The encoded transporter plays a role in regulation of intracellular calcium levels and transports L-type amino acids. Alternatively spliced transcript variants, encoding different isoforms, have been characterized. [provided by RefSeq, Nov 2010] |
| Protein Families | Transmembrane |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400390 | SLC3A2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC419347 | SLC3A2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC422810 | SLC3A2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC425326 | SLC3A2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC429102 | SLC3A2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400390 | Transient overexpression lysate of solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2 (SLC3A2), transcript variant 2 |
USD 396.00 |
|
| LY419347 | Transient overexpression lysate of solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2 (SLC3A2), transcript variant 3 |
USD 436.00 |
|
| LY422810 | Transient overexpression lysate of solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2 (SLC3A2), transcript variant 5 |
USD 665.00 |
|
| LY425326 | Transient overexpression lysate of solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2 (SLC3A2), transcript variant 5 |
USD 396.00 |
|
| LY429102 | Transient overexpression lysate of solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2 (SLC3A2), transcript variant 3 |
USD 396.00 |
|
| PH316693 | SLC3A2 MS Standard C13 and N15-labeled recombinant protein (NP_001012682) |
USD 2,055.00 |
|
| TP316640 | Recombinant protein of human solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2 (SLC3A2), transcript variant 3 |
USD 867.00 |
|
| TP316693 | Recombinant protein of human solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2 (SLC3A2), transcript variant 5 |
USD 748.00 |
|
| TP720445 | Recombinant protein of human solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2 (SLC3A2), transcript variant 2 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China