CD98 (SLC3A2) (NM_002394) Human Recombinant Protein
CAT#: TP316640
Recombinant protein of human solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2 (SLC3A2), transcript variant 3
View other "SLC3A2" proteins (14)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>Peptide sequence encoded by RC216640
Blue=ORF Red=Cloning site Green=Tag(s) MELQPPEASIAVVSIPRQLPGSHSEAGVQGLSAGDDSELGSHCVAQTGLELLASGDPLPSASQNAEMIE TGSDCVTQAGLQLLASSDPPALASKNAEVTGTMSQDTEVDMKEVELNELEPEKQPMNAASGAAMSLAGA EKNGLVKIKVAEDEAEAAAAAKFTGLSKEELLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVRA PRCRELPAQKWWHTGALYRIGDLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTD LLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGF QVRDIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYLSDSGSTGEH TKSLVTQYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQLMLFTLPGTPVFSYGDEIGLDAAALPGQP MEAPVMLWDESSFPDIPGAVSANMTVKGQSEDPGSLLSLFRRLSDQRSKERSLLHGDFHAFSAGPGLFS YIRHWDQNERFLVVLNFGDVGLSAGLQASDLPASASLPAKADLLLSTQPGREEGSPLELERLKLEPHEG LLLRFPYAA SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV Recombinant protein using RC216640 also available, TP316640M |
Tag | C-Myc/DDK |
Predicted MW | 67.8 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002385 |
Locus ID | 6520 |
UniProt ID | P08195 |
Cytogenetics | 11q12.3 |
Refseq Size | 2347 |
Refseq ORF | 1890 |
Synonyms | 4F2; 4F2HC; 4T2HC; CD98; CD98HC; MDU1; NACAE |
Summary | This gene is a member of the solute carrier family and encodes a cell surface, transmembrane protein. The protein exists as the heavy chain of a heterodimer, covalently bound through di-sulfide bonds to one of several possible light chains. The encoded transporter plays a role in regulation of intracellular calcium levels and transports L-type amino acids. Alternatively spliced transcript variants, encoding different isoforms, have been characterized. [provided by RefSeq, Nov 2010] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400390 | SLC3A2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC419347 | SLC3A2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC422810 | SLC3A2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC425326 | SLC3A2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC429102 | SLC3A2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400390 | Transient overexpression lysate of solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2 (SLC3A2), transcript variant 2 |
USD 396.00 |
|
LY419347 | Transient overexpression lysate of solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2 (SLC3A2), transcript variant 3 |
USD 396.00 |
|
LY422810 | Transient overexpression lysate of solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2 (SLC3A2), transcript variant 5 |
USD 605.00 |
|
LY425326 | Transient overexpression lysate of solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2 (SLC3A2), transcript variant 5 |
USD 396.00 |
|
LY429102 | Transient overexpression lysate of solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2 (SLC3A2), transcript variant 3 |
USD 396.00 |
|
PH316640 | SLC3A2 MS Standard C13 and N15-labeled recombinant protein (NP_002385) |
USD 2,055.00 |
|
PH316693 | SLC3A2 MS Standard C13 and N15-labeled recombinant protein (NP_001012682) |
USD 2,055.00 |
|
TP316693 | Recombinant protein of human solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2 (SLC3A2), transcript variant 5 |
USD 748.00 |
|
TP720445 | Recombinant protein of human solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2 (SLC3A2), transcript variant 2 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review