Prostaglandin D Synthase (PTGDS) (NM_000954) Human Mass Spec Standard

CAT#: PH316795

PTGDS MS Standard C13 and N15-labeled recombinant protein (NP_000945)

Product Images

Coomassie blue staining of purified PTGDS protein (Cat# TP316795). The protein was produced from HEK293T cells transfected with PTGDS cDNA clone (Cat# RC216795) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC216795
• Predicted MW: 20.8 kDa
• Protein Sequence:
  Sequence Link

  >RC216795 representing NM_000954
  Red=Cloning site Green=Tags(s)
  
  MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLASNSSWLREKKAALSMCKSVVA
  PATDGGLNLTSTFLRKNQCETRTMLLQPAGSLGSYSYRSPHWGSTYSVSVVETDYDQYALLYSQGSKGPG
  EDFRMATLYSRTQTPRAELKEKFTAFCKAQGFTEDTIVFLPQTDKCMTEQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000945
• RefSeq Size: 837
• RefSeq ORF: 570
• Synonyms: L-PGDS; LPGDS; PDS; PGD2; PGDS; PGDS2
• Locus ID: 5730
• UniProt ID: P41222, A0A024R8G3
• Cytogenetics: 9q34.3
• Summary: 'The protein encoded by this gene is a glutathione-independent prostaglandin D synthase that catalyzes the conversion of prostaglandin H2 (PGH2) to postaglandin D2 (PGD2). PGD2 functions as a neuromodulator as well as a trophic factor in the central nervous system. PGD2 is also involved in smooth muscle contraction/relaxation and is a potent inhibitor of platelet aggregation. This gene is preferentially expressed in brain. Studies with transgenic mice overexpressing this gene suggest that this gene may be also involved in the regulation of non-rapid eye movement sleep. [provided by RefSeq, Jul 2008]'
• Protein Pathways: Arachidonic acid metabolism, Metabolic pathways