p15 INK4b (CDKN2B) (NM_078487) Human Mass Spec Standard
CAT#: PH317024
CDKN2B MS Standard C13 and N15-labeled recombinant protein (NP_511042)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217024 |
| Predicted MW | 7.9 kDa |
| Protein Sequence |
>RC217024 representing NM_078487
Red=Cloning site Green=Tags(s) MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVAGAPGPRRQGARERGAR PRRIGAGT SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_511042 |
| RefSeq Size | 4001 |
| RefSeq ORF | 234 |
| Synonyms | CDK4I; INK4B; MTS2; P15; p15INK4b; TP15 |
| Locus ID | 1030 |
| UniProt ID | P42772 |
| Cytogenetics | 9p21.3 |
| Summary | 'This gene lies adjacent to the tumor suppressor gene CDKN2A in a region that is frequently mutated and deleted in a wide variety of tumors. This gene encodes a cyclin-dependent kinase inhibitor, which forms a complex with CDK4 or CDK6, and prevents the activation of the CDK kinases, thus the encoded protein functions as a cell growth regulator that controls cell cycle G1 progression. The expression of this gene was found to be dramatically induced by TGF beta, which suggested its role in the TGF beta induced growth inhibition. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. [provided by RefSeq, Jul 2008]' |
| Protein Families | Druggable Genome |
| Protein Pathways | Cell cycle, Pathways in cancer, Small cell lung cancer, TGF-beta signaling pathway |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409193 | CDKN2B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC417638 | CDKN2B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC429931 | CDKN2B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY409193 | Transient overexpression lysate of cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 2 |
USD 436.00 |
|
| LY417638 | Transient overexpression lysate of cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1 |
USD 436.00 |
|
| LY429931 | Transient overexpression lysate of cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 2 |
USD 396.00 |
|
| PH304895 | CDKN2B MS Standard C13 and N15-labeled recombinant protein (NP_004927) |
USD 2,055.00 |
|
| TP304895 | Recombinant protein of human cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1 |
USD 823.00 |
|
| TP317024 | Recombinant protein of human cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China