p15 INK4b (CDKN2B) (NM_004936) Human Recombinant Protein
CAT#: TP304895
Recombinant protein of human cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>Peptide sequence encoded by RC204895
Blue=ORF Red=Cloning site Green=Tag(s) MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHG AEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV Recombinant protein using RC204895 also available, TP304895M |
| Tag | C-Myc/DDK |
| Predicted MW | 14.5 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004927 |
| Locus ID | 1030 |
| UniProt ID | P42772, K7PPU3 |
| Cytogenetics | 9p21.3 |
| Refseq Size | 3878 |
| Refseq ORF | 414 |
| Synonyms | CDK4I; INK4B; MTS2; P15; p15INK4b; TP15 |
| Summary | This gene lies adjacent to the tumor suppressor gene CDKN2A in a region that is frequently mutated and deleted in a wide variety of tumors. This gene encodes a cyclin-dependent kinase inhibitor, which forms a complex with CDK4 or CDK6, and prevents the activation of the CDK kinases, thus the encoded protein functions as a cell growth regulator that controls cell cycle G1 progression. The expression of this gene was found to be dramatically induced by TGF beta, which suggested its role in the TGF beta induced growth inhibition. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Cell cycle, Pathways in cancer, Small cell lung cancer, TGF-beta signaling pathway |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409193 | CDKN2B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC417638 | CDKN2B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC429931 | CDKN2B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY409193 | Transient overexpression lysate of cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 2 |
USD 436.00 |
|
| LY417638 | Transient overexpression lysate of cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1 |
USD 436.00 |
|
| LY429931 | Transient overexpression lysate of cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 2 |
USD 396.00 |
|
| PH304895 | CDKN2B MS Standard C13 and N15-labeled recombinant protein (NP_004927) |
USD 2,055.00 |
|
| PH317024 | CDKN2B MS Standard C13 and N15-labeled recombinant protein (NP_511042) |
USD 2,055.00 |
|
| TP317024 | Recombinant protein of human cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China