FAM108B1 (ABHD17B) (NM_016014) Human Mass Spec Standard

CAT#: PH317164

FAM108B1 MS Standard C13 and N15-labeled recombinant protein (NP_057098)

Product Images

Coomassie blue staining of purified ABHD17B protein (Cat# TP317164). The protein was produced from HEK293T cells transfected with ABHD17B cDNA clone (Cat# RC217164) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC217164
• Predicted MW: 32.6 kDa
• Protein Sequence:
  Sequence Link

  >RC217164 representing NM_016014
  Red=Cloning site Green=Tags(s)
  
  MNNLSFSELCCLFCCPPCPGKIASKLAFLPPDPTYTLMCDESGSRWTLHLSERADWQYSSREKDAIECFM
  TRTSKGNRIACMFVRCSPNAKYTLLFSHGNAVDLGQMSSFYIGLGSRINCNIFSYDYSGYGASSGKPTEK
  NLYADIEAAWLALRTRYGIRPENVIIYGQSIGTVPSVDLAARYESAAVILHSPLTSGMRVAFPDTKKTYC
  FDAFPNIDKISKITSPVLIIHGTEDEVIDFSHGLALFERCQRPVEPLWVEGAGHNDVELYGQYLERLKQF
  VSQELVQKHKEGK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057098
• RefSeq Size: 1614
• RefSeq ORF: 879
• Synonyms: C9orf77; CGI-67; FAM108B1
• Locus ID: 51104
• UniProt ID: Q5VST6
• Cytogenetics: 9q21.13
• Protein Families: Protease